Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9D8T2
Molecular weight:
42.87 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Met1–Asp276
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Product name ARO-P10935-100
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276
Product name ARO-P10935-1MG
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276
Product name ARO-P10935-50
Uniprot ID Q9D8T2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSD
Molecular weight 42.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp276
Aliases /Synonyms Gasdermin-D, Gasdermin domain-containing protein 1, Gasdermin-D, N-terminal, GSDMD-NT, mGSDMD-NTD, p30, Gasdermin-D, C-terminal, GSDMD-CT, mGSDMD-CTD, p20, Gsdmd, Gsdmdc1
Reference ARO-P10935
Note For research use only.
Molecular Constructor
Met1–Asp276

Introduction

Recombinant Mouse GSDMD/Gasdermin-D Protein is a highly sought-after protein in the field of immunology and cell biology. It is a member of the Gasdermin family, which consists of six proteins that play important roles in various cellular processes such as cell death, inflammation, and cell differentiation. The recombinant form of this protein has been extensively studied and has shown great potential in various applications, making it a valuable tool for researchers.

Structure of Recombinant Mouse GSDMD/Gasdermin-D Protein

The recombinant form of GSDMD/Gasdermin-D protein is a 55 kDa protein composed of 484 amino acids. It consists of an N-terminal domain (NTD), a central domain (CD), and a C-terminal domain (CTD). The NTD contains a conserved domain known as the gasdermin domain, which is responsible for the pore-forming activity of the protein. The CD is highly variable among different members of the Gasdermin family and is involved in protein-protein interactions. The CTD contains a conserved domain called the repressor domain, which regulates the pore-forming activity of the protein.

Activity of Recombinant Mouse GSDMD/Gasdermin-D Protein

GSDMD/Gasdermin-D protein is primarily known for its role in pyroptosis, a form of cell death that is triggered by inflammatory signals. In its inactive form, GSDMD/Gasdermin-D protein is bound to the plasma membrane of cells. Upon activation by inflammatory signals, the protein undergoes cleavage by inflammatory caspases, resulting in the release of the N-terminal fragment. This fragment then forms pores in the plasma membrane, leading to cell death. In addition to pyroptosis, GSDMD/Gasdermin-D protein has also been implicated in other forms of cell death, such as apoptosis and necroptosis.

Application of Recombinant Mouse GSDMD/Gasdermin-D Protein

The recombinant form of GSDMD/Gasdermin-D protein has a wide range of applications in the fields of immunology and cell biology. One of its main applications is in the study of pyroptosis and other forms of cell death. Researchers can use recombinant GSDMD/Gasdermin-D protein to induce pyroptosis in cells and study its mechanisms. This can provide valuable insights into the role of this protein in various cellular processes and diseases.

Furthermore, recombinant GSDMD/Gasdermin-D protein can also be used as an antigen in immunological studies. Its ability to form pores in the plasma membrane makes it an excellent target for the immune system, making it a valuable tool for vaccine development. In addition, the protein can also be used in diagnostic tests for various diseases, as its levels have been found to be altered in certain conditions.

Moreover, recombinant GSDMD/Gasdermin-D protein has been shown to have potential therapeutic applications. Its role in inflammation and cell death makes it a promising target for the treatment of inflammatory diseases. In addition, its ability to induce cell death in cancer cells makes it a potential candidate for cancer therapy.

Conclusion

In summary, recombinant GSDMD/Gasdermin-D protein is a highly versatile protein with important roles in cell death, inflammation, and immunity. Its structure and activity have been extensively studied, and its potential applications in various fields make it a valuable tool for researchers. As our understanding of this protein continues to grow, it is likely that it will play an even greater role in advancing

SDS-PAGE for Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

SDS-PAGE for Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse GSDMD/Gasdermin-D Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products