Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse SAA1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P05366
Molecular weight:
24.10 kDa

Original price was: $334.00.Current price is: $274.00.

50ug 18% OFF + 274 loyalty points
Gly20–Tyr122
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse SAA1 Protein, N-His-SUMO

Product name ARO-P10611-100
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122
Product name ARO-P10611-1MG
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122
Product name ARO-P10611-50
Uniprot ID P05366
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Molecular weight 24.10 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly20-Tyr122
Aliases /Synonyms SAA, Serum amyloid A-1 protein, SAA1, Amyloid fibril protein AA
Reference ARO-P10611
Note For research use only.
Molecular Constructor
Gly20–Tyr122

Structure of Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein is a type of protein that is produced through genetic engineering techniques in a laboratory setting. This protein is a member of the serum amyloid A (SAA) family, which plays a crucial role in the body’s immune response and inflammation processes. The structure of this protein is highly conserved across different species, including humans and mice.

The recombinant mouse SAA1 protein is composed of 104 amino acids, with a molecular weight of approximately 12 kDa. It is a single-chain protein with a three-dimensional structure that consists of both alpha-helices and beta-sheets. The N-terminal region of the protein contains a signal peptide, which helps in the secretion of the protein from the cells.

The crystal structure of recombinant mouse SAA1 protein has been determined, providing insights into its functional and structural properties. The structure reveals that the protein forms a dimer, with each monomer consisting of four helices and a beta-sheet. The dimerization of the protein is essential for its stability and function.

Activity of Recombinant Mouse SAA1 Protein

The primary function of recombinant mouse SAA1 protein is to act as an acute-phase protein, which is produced in response to infection, injury, or inflammation. It is primarily produced by the liver and secreted into the bloodstream. The protein has been shown to have both pro-inflammatory and anti-inflammatory activities, depending on the context of its production.

One of the key activities of recombinant mouse SAA1 protein is its role in the innate immune response. It acts as an opsonin, which means that it binds to and enhances the phagocytosis of pathogens by immune cells. This helps in the clearance of infections and promotes tissue repair.

In addition to its immune-modulating functions, recombinant mouse SAA1 protein has also been shown to have a role in lipid metabolism. It binds to cholesterol and other lipids, promoting their transport and clearance from tissues. This activity is important in maintaining lipid homeostasis and preventing the formation of atherosclerotic plaques.

Application of Recombinant Mouse SAA1 Protein

Recombinant Mouse SAA1 Protein has various applications in both research and clinical settings. Due to its role in the immune response, it is commonly used as an antigen in immunological studies. It can be used to generate antibodies for research purposes, as well as for diagnostic tests for various inflammatory conditions.

In addition, recombinant mouse SAA1 protein has been studied as a potential therapeutic agent for inflammatory diseases. Its ability to modulate the immune response and lipid metabolism makes it a promising candidate for the treatment of conditions such as rheumatoid arthritis, atherosclerosis, and sepsis.

Furthermore, the crystal structure of recombinant mouse SAA1 protein has been utilized in drug design studies. Researchers have identified potential binding sites on the protein that could be targeted for the development of novel anti-inflammatory drugs.

In conclusion, recombinant mouse SAA1 protein is a versatile protein with important functions in the immune response and lipid metabolism. Its structural and functional properties make it a valuable tool for research and a potential therapeutic target for various diseases. Further studies on this protein could lead to the development of new treatments for inflammatory conditions and contribute to a better understanding of the immune system.

Recombinant Mouse SAA1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse SAA1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products