Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ctf2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P83714
Molecular weight:
21.69 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Ser26–Ala204
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ctf2 Protein, N-His

Product name ARO-P10567-100
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204
Product name ARO-P10567-1MG
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204
Product name ARO-P10567-50
Uniprot ID P83714
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
Molecular weight 21.69 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Ala204
Aliases /Synonyms Cardiotrophin-2, CT-2, Neuropoietin, Np, Ctf2, Gm494
Reference ARO-P10567
Note For research use only.
Molecular Constructor
Ser26–Ala204

Introduction to Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein, also known as Chromosome Transmission Fidelity 2 Protein, is a key component of the replication machinery in eukaryotic cells. It plays a crucial role in maintaining the stability and integrity of the genome during DNA replication. This protein is highly conserved across species and is essential for cell viability. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse Ctf2 Protein.

Structure of Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein is a 116 kDa protein that is composed of 1022 amino acids. It is a member of the Ctf2/Ctf18 family of replication proteins and is highly homologous to its human counterpart. The protein contains several functional domains, including an N-terminal domain, a central domain, and a C-terminal domain. These domains are responsible for the protein’s interaction with other replication factors and its role in DNA replication.

N-terminal domain

The N-terminal domain of Recombinant Mouse Ctf2 Protein is responsible for its interaction with the replication factor C (RFC). RFC is a heteropentameric complex that plays a crucial role in loading the proliferating cell nuclear antigen (PCNA) onto DNA during replication. This interaction is essential for the recruitment of Recombinant Mouse Ctf2 Protein to the replication fork.

Central domain

The central domain of Recombinant Mouse Ctf2 Protein contains a winged helix domain that is responsible for its interaction with DNA. This domain binds to the single-stranded DNA present at the replication fork and helps in stabilizing the DNA during replication.

C-terminal domain

The C-terminal domain of Recombinant Mouse Ctf2 Protein is responsible for its interaction with other replication factors, such as Ctf18 and Dpb11. These interactions are crucial for the protein’s function in DNA replication and ensure the fidelity of DNA synthesis.

Activity of Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein plays a crucial role in the replication process by ensuring the faithful duplication of the genome. It is involved in several activities that contribute to the stability and fidelity of DNA replication.

Stabilization of the replication fork

Recombinant Mouse Ctf2 Protein binds to the replication fork and helps in stabilizing it during DNA synthesis. This ensures that the DNA is not damaged or lost during replication, thereby maintaining the integrity of the genome.

Recruitment of other replication factors

The interaction of Recombinant Mouse Ctf2 Protein with other replication factors, such as RFC, Ctf18, and Dpb11, helps in recruiting them to the replication fork. This ensures the coordinated action of these factors in DNA replication and prevents errors in DNA synthesis.

Regulation of replication origin firing

Recombinant Mouse Ctf2 Protein also plays a role in regulating the timing of replication origin firing. It interacts with the Origin Recognition Complex (ORC) and prevents the firing of late origins, thereby maintaining the proper timing of DNA replication.

Applications of Recombinant Mouse Ctf2 Protein

Recombinant Mouse Ctf2 Protein has several applications in the field of molecular biology and genetics. Some of the major applications are listed below:

Study of DNA replication

Recombinant Mouse Ctf2 Protein is an essential component of the DNA replication machinery and its study has provided valuable insights into the process of DNA synthesis. Its role in stabilizing the replication fork and recruiting other replication factors makes it an important protein for understanding the mechanisms of DNA replication.

Antigen for antibody production

Recombinant Mouse Ctf2 Protein can be used as an antigen for the production of specific antibodies. These antibodies can be used for various applications, such as western blotting

Recombinant Mouse Ctf2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse Ctf2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products