Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sarilumab Biosimilar – Anti-IL-6R mAb – Research Grade

  • PX-TA1028-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sarilumab Biosimilar - Anti-IL-6R mAb - Research Grade

Product name Sarilumab Biosimilar - Anti-IL-6R mAb - Research Grade
Uniprot ID P08887
Source DrugBank DB11767
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sarilumab,Sarilumab,IL-6R,anti-IL-6R
Reference PX-TA1028
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Sarilumab Biosimilar - Anti-IL-6R mAb - Research Grade
Uniprot ID P08887
Source DrugBank DB11767
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sarilumab,Sarilumab,IL-6R,anti-IL-6R
Reference PX-TA1028
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name PX-TA1028-50
Uniprot ID P08887
Source DrugBank DB11767
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Molecular weight 150kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Sarilumab,Sarilumab,IL-6R,anti-IL-6R
Reference PX-TA1028
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Sarilumab Therapeutic Antibody

The Sarilumab antibody is a fully human IgG1 kappa monoclonal protein targeting the human interleukin 6 receptor (IL-6R). It has been generated using the VelocImmune® platform by Regeneron Pharmaceuticals Inc. which consists of immunizing engineered mice modified to produce fully human antibodies instead of murine immunoglobulins. Sarilumab was granted approval by the Food and Drug Administration (FDA) in 2017 for the treatment of rheumatoid arthritis (RA), an autoimmune condition. RA is a long-term condition affecting hands, feet, and wrists often causing tiredness and weight loss.

Sarilumab and Tocilizumab (a humanized monoclonal antibody) share the same molecular target and mechanism of action. By competitively binding the IL-6R, both antibodies are known to disrupt the pro-inflammatory response caused by the interleukin 6 (IL-9) molecule, a small soluble glycoprotein known to be overexpressed in multiple inflammatory pathologies such as the cytokine release syndrome or “cytokine storm.” Both antibodies have proved their effectiveness as monoclonal antibody therapies in vitro and the clinic.

However, recent studies have shown that Sarilumab’s in vitro binding affinity is 15-22-fold higher than that of Tocilizumab. The improved affinity also translated into a better clinical efficiency suggesting that Sarilumab is capable of effectively blocking the IL-6R with a lower dose and dosage frequency than the ones recurrently necessary in Tocilizumab-based therapies. Consequently, Sarilumab may have an overall lower cost than its humanized counterpart for the treatment of multiple diseases.

The evaluation of Sarilumab as a COVID-19 treatment is currently under regulatory revision. Prior studies with this therapeutic antibody showed a marked improvement in patients in intensive care (over 89% of patients experienced a significant improvement after receiving the antibody intravenously). However, further studies are necessary to access the efficiency and safety of the fully human therapeutic antibody for blocking IL-6R in COVID-19 patients and arrest the onset of the acute respiratory distress syndrome (ARDS) shown to contribute to significant lung damage in the most severe cases of the disease. This product is for research use only.

SDS-PAGE for Sarilumab Biosimilar - Anti-IL-6R mAb

SDS-PAGE for Sarilumab Biosimilar - Anti-IL-6R mAb

Sarilumab Biosimilar - Anti-IL-6R mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sarilumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Sarilumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Sarilumab Biosimilar - Anti-IL-6R mAb (cat. No.PX-TA1028) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Sarilumab Biosimilar - Anti-IL-6R mAb - Research Grade

There are no reviews yet.

Be the first to review “Sarilumab Biosimilar – Anti-IL-6R mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products