Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sovipostobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1951-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1951-50
Uniprot ID P16410
Source CAS: 2649371-19-5
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1951
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: Understanding the Structure and Function of Sovipostobart Biosimilar – Anti-CD152 mAb

Introduction:

Sovipostobart Biosimilar – Anti-CD152 mAb is a monoclonal antibody that has been developed as a potential therapeutic for various diseases. In this article, we will explore the structure, activity, and potential applications of this biosimilar in detail.

Structure of Sovipostobart Biosimilar – Anti-CD152 mAb:

Sovipostobart Biosimilar – Anti-CD152 mAb is a biosimilar of the anti-CD152 monoclonal antibody. It is a fully humanized IgG1 antibody, meaning that it is made up of four protein chains – two heavy chains and two light chains. The heavy chains are composed of constant (C) and variable (V) regions, while the light chains consist of only variable regions. The variable regions are responsible for binding to the target antigen, CD152.

Activity of Sovipostobart Biosimilar – Anti-CD152 mAb:

CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), is a protein that is expressed on the surface of T cells. It plays a crucial role in regulating the immune response by inhibiting T cell activation. However, in certain diseases, such as cancer, CD152 can be overexpressed, leading to suppression of the immune response and allowing cancer cells to evade detection and destruction by the immune system.

Sovipostobart Biosimilar – Anti-CD152 mAb works by binding to CD152 and blocking its inhibitory activity. This allows for the activation of T cells and a stronger immune response against cancer cells. Additionally, Sovipostobart Biosimilar – Anti-CD152 mAb can also enhance the activity of other immunotherapies, such as checkpoint inhibitors, by preventing the binding of CD152 to its ligands.

Applications of Sovipostobart Biosimilar – Anti-CD152 mAb:

The primary application of Sovipostobart Biosimilar – Anti-CD152 mAb is in the treatment of cancer. It has shown promising results in preclinical studies and is currently undergoing clinical trials for various types of cancer, including melanoma, lung cancer, and lymphoma. Additionally, Sovipostobart Biosimilar – Anti-CD152 mAb has also shown potential in the treatment of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, where CD152 overexpression is also observed.

Advantages of Sovipostobart Biosimilar – Anti-CD152 mAb:

Compared to other anti-CD152 antibodies, Sovipostobart Biosimilar – Anti-CD152 mAb has several advantages. Being a fully humanized antibody, it has a lower risk of immune reactions and is more effective in binding to its target. It also has a longer half-life, meaning that it can remain in the body for a longer period, providing sustained therapeutic effects. Additionally, Sovipostobart Biosimilar – Anti-CD152 mAb has a lower production cost, making it more accessible for patients.

Conclusion:

Sovipostobart Biosimilar – Anti-CD152 mAb is a promising therapeutic option for cancer and autoimmune diseases. Its unique structure and mechanism of action make it a highly effective and safe treatment option. With ongoing clinical trials, it has the potential to improve outcomes for patients with these diseases.

Research Grade Sovipostobart binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Sovipostobart binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Sovipostobart in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Sovipostobart

SDS-PAGE for Research Grade Sovipostobart

Research Grade Sovipostobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sovipostobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sovipostobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products