Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

T-cell surface glycoprotein CD8 alpha chain(CD8A)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01732

$250.00

50ug + 250 loyalty points
Met1–Asp182 Twin-Strep
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

T-cell surface glycoprotein CD8 alpha chain(CD8A)

Product name T-cell surface glycoprotein CD8 alpha chain(CD8A)
Uniprot ID P01732
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Protein delivered with Tag? C-terminal Twin-Strep Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asp182
Aliases /Synonyms T-lymphocyte differentiation antigen T8/Leu-2,CD8a,MAL
Reference PX-P4639
Note For research use only
Molecular Constructor
Met1–Asp182 Twin-Strep
Product name T-cell surface glycoprotein CD8 alpha chain(CD8A)
Uniprot ID P01732
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Protein delivered with Tag? C-terminal Twin-Strep Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asp182
Aliases /Synonyms T-lymphocyte differentiation antigen T8/Leu-2,CD8a,MAL
Reference PX-P4639
Note For research use only
Molecular Constructor
Met1–Asp182 Twin-Strep

T-cell surface glycoprotein CD8 alpha chain(CD8A)

There are no reviews yet.

Be the first to review “T-cell surface glycoprotein CD8 alpha chain(CD8A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products