Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Anoctamin-6(Ano6)

Host species:
Mammalian cells
Uniprot ID:
Q6P9J9

$500.00

100ug + 500 loyalty points
Ala745–Asn825
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anoctamin-6(Ano6)

Anoctamin-6(Ano6)

Product name Anoctamin-6(Ano6)
Uniprot ID Q6P9J9
Uniprot link https://www.uniprot.org/uniprot/Q6P9J9
Expression system Eukaryotic expression
Sequence MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNGSHHHHHH
Purity estimated >10%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala745-Asn825
Aliases /Synonyms Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference PX-P4625
Note For research use only
Molecular Constructor
Ala745–Asn825
Product name Anoctamin-6(Ano6)
Uniprot ID Q6P9J9
Uniprot link https://www.uniprot.org/uniprot/Q6P9J9
Expression system Eukaryotic expression
Sequence MGWSCIILFLVATATGVHSAFTSDMIPRLVYYWSFSIPPYGDHTYYTMDGYINNTLSVFNITDFKNTDKENPYIGLGNYTLCRYRDFRNPPGHPQEYKHNGSHHHHHH
Purity estimated >10%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala745-Asn825
Aliases /Synonyms Small-conductance calcium-activated nonselective cation channel,SCAN channel,Transmembrane protein 16F,Tmem16f
Reference PX-P4625
Note For research use only
Molecular Constructor
Ala745–Asn825

There are no reviews yet.

Be the first to review “Anoctamin-6(Ano6)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products