Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

TwinStrep-NusA-3C-MMP

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0A0B4K7H5
Molecular weight:
86.11kDa

$250.00

50ug + 250 loyalty points
Ala20–Glu267
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

TwinStrep-NusA-3C-MMP

Product name TwinStrep-NusA-3C-MMP
Uniprot ID A0A0B4K7H5
Uniprot link https://www.uniprot.org/uniprot/A0A0B4K7H5
Expression system Prokaryotic expression
Sequence MGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQ IDRKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVD QFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRSKPEMLIEL FRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAM APADVASIVVDEDKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQAEAHAAIDTFTKYLDIDED FATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLGDNKPADDLLNLEGVDRDLAFKL AARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEALEVLFQGPAAAQSAPVSTTTQAEIYLSQFGYLP ASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDD AELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPVFKLDEDDKAAIQSLY
Molecular weight 86.11kDa
Purity estimated 90%
Buffer TBS pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20-Glu267
Aliases /Synonyms Matrix metalloproteinase 1
Reference PX-P4259
Note For research use only
Molecular Constructor
Ala20–Glu267
Product name TwinStrep-NusA-3C-MMP
Uniprot ID A0A0B4K7H5
Uniprot link https://www.uniprot.org/uniprot/A0A0B4K7H5
Origin species Drosophila
Expression system Prokaryotic expression
Sequence MGASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQ IDRKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAERAMVVD QFREHEGEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRSKPEMLIEL FRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAM APADVASIVVDEDKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQAEAHAAIDTFTKYLDIDED FATVLVEEGFSTLEELAYVPMKELLEIEGLDEPTVEALRERAKNALATIAQAQEESLGDNKPADDLLNLEGVDRDLAFKL AARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEALEVLFQGPAAAQSAPVSTTTQAEIYLSQFGYLP ASARNPASSGLHDQRTWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRDRVGTGDSRSKRYALQGSRWRVKNLTYK ISKYPKRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTSGPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPVFGGDAHFDD AELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRGFEPVFKLDEDDKAAIQSLY
Molecular weight 86.11kDa
Purity estimated 90%
Buffer TBS pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala20-Glu267
Aliases /Synonyms Matrix metalloproteinase 1
Reference PX-P4259
Note For research use only
Molecular Constructor
Ala20–Glu267

General information on MMP Protein

MMP protein stands for matrix metallopeptidases, matrix metalloproteinases or matrixins which are calcium-dependent zinc-containing endopeptidases. MMPs proteins are capable of degrading different protein components of the Extracellular Matrix. Data has shown (Wilson et al. 1997) that MMP protein knockout indicate that these proteinases act on a variety of extracellular proteins such as cytokines, chemokines, antimicrobial peptides. They are also involved in the cleavage of cell surface receptors, the release of apoptotic ligands (such as the FAS ligand). MMPs proteins are believed to play a major role in cell behaviors such as cell differentiation, proliferation, migration, apoptosis, angiogenesis and host defense. MMPs carry out effector roles in a variety of biological and disease processes including inflammation and immunity. MMPs proteins are secreted and anchored to the surface of the cell.
MMP1 protein, which is also known as interstitial collagenase and fibroblast collagenase, is an enzyme involved in collagen degradation. More precisely, MMP-1 breaks down the interstitial collagens, types I, II and III, VII and X. MPP1 protein has also been shown to interact with CD49b. MMP1 protein has an archetypal structure consisting of a pre-domain, a pro-domain, a catalytic domain, a hemopexin-like domain and a linker region. The Catalytic Domain of MMP-1 is composed of five β-strands (sI-sV), three α-helix (hA-hC) and a total of eight loops, enclosing three Ca2+ metal ions and two Zn2+ metal ions.
In case of an increase of the mechanical force, the expression of MMP1 in human periodontal ligament may also be increases. In case of HIV infection, interacts and cleaves the viral Tat protein. This step leads to a decrease in neuronal Tat’s mediated neurotoxicity. High MPP1 protein expression levels have been associated with enhanced breast cancer growth and metastasis. MMP1 overexpression has been linked to significantly reduced drug sensitivity and may also predict poor prognosis.

There are no reviews yet.

Be the first to review “TwinStrep-NusA-3C-MMP”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products