Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ulenistamab Biosimilar – Anti-PAUF mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $541.00.Current price is: $440.00.

100ug 19% OFF + 440 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade

Product name Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade
Uniprot ID Q96DA0
Source CAS: 2415259-90-2
Species Humanized
Raw Antigen Sequence MLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ulenistamab,PBP 1510, PBP-1510, PBP1510,PAUF,anti-PAUF
Reference PX-TA1773
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade
Uniprot ID Q96DA0
Source CAS: 2415259-90-2
Species Humanized
Raw Antigen Sequence MLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ulenistamab,PBP 1510, PBP-1510, PBP1510,PAUF,anti-PAUF
Reference PX-TA1773
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1773-50
Uniprot ID Q96DA0
Source CAS: 2415259-90-2
Species Humanized
Raw Antigen Sequence MLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ulenistamab,PBP 1510, PBP-1510, PBP1510,PAUF,anti-PAUF
Reference PX-TA1773
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Ulenistamab Biosimilar

Ulenistamab biosimilar, also known as anti-PAUF mAb, is a monoclonal antibody that is designed to target the protein PAUF (pancreatic adenocarcinoma upregulated factor). This protein is overexpressed in many types of cancer, including pancreatic, lung, and breast cancer, making it a promising therapeutic target.

The structure of ulenistamab biosimilar is similar to that of the original ulenistamab, which is a fully humanized monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of two constant regions (CL) and one variable region (VL).

The variable regions of ulenistamab biosimilar are responsible for its specificity and binding to the PAUF protein. These regions are highly diverse and can recognize and bind to specific targets, such as PAUF. The constant regions, on the other hand, are responsible for the effector functions of the antibody, such as activating the immune system to destroy cancer cells.

The Activity of Ulenistamab Biosimilar

Ulenistamab biosimilar works by binding to the PAUF protein, which is overexpressed in cancer cells. This binding prevents the PAUF protein from interacting with its receptors on the surface of cancer cells, thereby inhibiting its signaling pathways. This results in the suppression of cancer cell growth and proliferation.

In addition to directly inhibiting the PAUF protein, ulenistamab biosimilar also activates the immune system to attack and destroy cancer cells. This is achieved through the effector functions of the constant regions of the antibody, which can trigger various immune responses, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Furthermore, ulenistamab biosimilar has been shown to have a longer half-life compared to other anti-PAUF mAbs, allowing for sustained activity and potentially reducing the frequency of dosing.

The Application of Ulenistamab Biosimilar

Ulenistamab biosimilar is currently being developed for the treatment of various types of cancer, including pancreatic, lung, and breast cancer. Its specificity for the PAUF protein makes it a promising therapeutic option for these types of cancer, which are known to have high levels of PAUF expression.

In addition, ulenistamab biosimilar has the potential to be used in combination with other cancer treatments, such as chemotherapy and radiation therapy, to enhance their efficacy. Its ability to activate the immune system can also make it a valuable addition to immunotherapy regimens.

Ulenistamab biosimilar is currently in the research grade stage, undergoing preclinical and clinical studies to evaluate its safety and efficacy. These studies will provide valuable data to support its potential application as a therapeutic option for cancer patients.

Conclusion

Ulenistamab biosimilar, also known as anti-PAUF mAb, is a promising monoclonal antibody that targets the PAUF protein, which is overexpressed in many types of cancer. Its structure, activity, and potential applications make it a valuable addition to the arsenal of cancer treatments. As research and development continue, ulenistamab biosimilar holds the potential to improve the outcomes of cancer patients and contribute to the fight against this devastating disease.

SDS-PAGE for Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade

SDS-PAGE for Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade

Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ulenistamab Biosimilar - Anti-PAUF mAb - Research Grade

There are no reviews yet.

Be the first to review “Ulenistamab Biosimilar – Anti-PAUF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products