Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade

  • PX-TA1975-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

Product name Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1975-50
Uniprot ID P05231
Source CAS: 2744320-12-3
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA1975
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a novel monoclonal antibody (mAb) developed by Vamikibart Biosciences for research purposes. This biosimilar is designed to target the Hybridoma growth factor, a protein involved in the growth and survival of hybridoma cells, which are commonly used in the production of monoclonal antibodies. In this article, we will discuss the structure, activity, and potential applications of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade.

Structure of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a recombinant, humanized monoclonal antibody, meaning that it is produced using recombinant DNA technology and has been engineered to have a human-like structure. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the Hybridoma growth factor, while the constant regions provide stability and effector functions.

Activity of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade works by specifically binding to the Hybridoma growth factor and inhibiting its activity. This prevents the growth and survival of hybridoma cells, which are essential for the production of monoclonal antibodies. By targeting the Hybridoma growth factor, this biosimilar can effectively reduce the production of unwanted antibodies and improve the quality of monoclonal antibody production.

Applications of Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade has several potential applications in the field of antibody research. Some of these include:

1. Hybridoma Cell Culture: Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade can be used to improve the efficiency and quality of hybridoma cell culture by inhibiting the growth and survival of hybridoma cells. This can lead to higher yields of monoclonal antibodies and reduce the need for multiple rounds of cell culture.

2. Antibody Production: Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade can be used in the production of therapeutic monoclonal antibodies. By targeting the Hybridoma growth factor, this biosimilar can improve the specificity and purity of the produced antibodies, leading to better therapeutic outcomes.

3. Antibody Engineering: Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade can also be used in antibody engineering studies. Its specific binding to the Hybridoma growth factor can help researchers understand the role of this protein in antibody production and explore potential ways to improve antibody engineering techniques.

4.

Cancer Research: The Hybridoma growth factor has been implicated in the growth and metastasis of certain types of cancer. Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade can be used in cancer research to study the role of this protein in cancer progression and explore its potential as a therapeutic target.

Conclusion

Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a novel monoclonal antibody with potential applications in antibody research, antibody production, and cancer research. Its specific binding to the Hybridoma growth factor makes it a valuable tool for improving the efficiency and quality of antibody production and understanding the role of this protein in various biological processes. Further studies and clinical trials are needed to fully explore the potential of this biosimilar in research and therapeutic settings.

SDS-PAGE for Research Grade Vamikibart

SDS-PAGE for Research Grade Vamikibart

Research Grade Vamikibart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Vamikibart in WB Assay

Research Grade Vamikibart in WB Assay

Research Grade Vamikibart can bind to its target in Western Blot Assay as detected on gel analysis.

Vamikibart Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

There are no reviews yet.

Be the first to review “Vamikibart Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products