size	100ug, 200ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Mammalian cells
Applications	Elisa, WB

Cancer

Product name	Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein
Uniprot ID	E2RKZ5
Uniprot link	http://www.uniprot.org/uniprot/E2RKZ5
Origin species	Dog
Expression system	Eukaryotic expression
Sequence	MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH
Molecular weight	25.94 kDa
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Partial
NCBI Reference	E2RKZ5
Biological activity	Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml.
Aliases /Synonyms	CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1
Reference	PX-P3014
Note	For research use only

Description of Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

General information on Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis.

Datasheet Download

MSDS Download

Publication

1: Shosu K, Sakurai M, Inoue K, Nakagawa T, Sakai H, Morimoto M, Okuda M, Noguchi S, Mizuno T. Programmed Cell Death Ligand 1 Expression in Canine Cancer. In Vivo. 2016 May-Jun;30(3):195-204. PubMed PMID: 27107075.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein”

Price and Availability

size

Clear

GET A QUOTE NOW

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Contact us

Send us a message from the form below

Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

Description of Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein

General information on Dog Programmed death ligand 1(PDL1)/CD274 Recombinant Protein

REVIEW YOUR PRODUCT

Atezolizumab Biosimilar – Anti-CD274, B7-H1, PDL1 mAb – Research Grade

Garivulimab Biosimilar – Anti-CD274 mAb – Research Grade

Opucolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Sudubrilimab Biosimilar – Anti-CD274 mAb – Research Grade

Sugemalimab Biosimilar – Anti-PDL1 mAb – Research Grade

Socazolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Tagitanlimab Biosimilar – Anti-PDL1 mAb – Research Grade

Simridarlimab Biosimilar – Anti-PDL1 & MER6 mAb – Research Grade

Adebrelimab Biosimilar – Anti-PDL1 mAb – Research Grade

BMS-936559/MDX-1105 Biosimilar – Anti-B7-H1 mAb – Research Grade

Contact us

Cart (0 Items)