Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human IL6 Antibody (SAA0375), FITC

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Clone Name:
SAA0375

Original price was: $193.00.Current price is: $157.00.

50ug 19% OFF + 157 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human IL6 Antibody (SAA0375), FITC

Product name ARO-A10844-100
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A10844
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Clone Name SAA0375
Product name ARO-A10844-1MG
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A10844
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Clone Name SAA0375
Product name ARO-A10844-50
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A10844
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Clone Name SAA0375

There are no reviews yet.

Be the first to review “Anti-Human IL6 Antibody (SAA0375), FITC”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products