Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human IL6 (Iv0022)

  • ARO-A13357-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $424.00.Current price is: $305.00.

50ug 28% OFF + 305 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)
Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)
SDS-PAGE for InVivoMAb Anti-Human IL6 (Iv0022)
SEC-HPLC of InVivoMAb Anti-Human IL6 (Iv0022)
InVivoMAb Anti-Human IL6 (Iv0022) binds to IL6, C-His, recombinant protein in WB Assay

InVivoMAb Anti-Human IL6 (Iv0022)

Product name ARO-A13357-100
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor
Product name ARO-A13357-1MG
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor
Product name ARO-A13357-50
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow-cytometry using anti-human IL6 antibody.LPS treated THP-1 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IL6 antibody monoclonal antibody (Catalog # ARO-A13357 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow-cytometry using anti-human IL6 antibody.IL6 Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IL6 antibody monoclonal antibody (Catalog # ARO-A13357 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human IL6 (Iv0022)

SDS-PAGE for InVivoMAb Anti-Human IL6 (Iv0022)

InVivoMAb Anti-Human IL6 (Iv0022), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of InVivoMAb Anti-Human IL6 (Iv0022)

SEC-HPLC of InVivoMAb Anti-Human IL6 (Iv0022)

InVivoMAb Anti-Human IL6 (Iv0022) was analyzed by size exclusion chromatography with UV detection.

InVivoMAb Anti-Human IL6 (Iv0022) binds to IL6, C-His, recombinant protein in WB Assay

InVivoMAb Anti-Human IL6 (Iv0022) binds to IL6, C-His, recombinant protein in WB Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) can bind InVivoMAb Anti-Human IL6 (Iv0022) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IL6 (Iv0022)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products