Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade

  • PX-TA2209-100
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $321.00.Current price is: $238.00.

100ug 26% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade

Product name PX-TA2209-50
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Product name Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody
Product name Pacibekitug Biosimilar - Anti-Hybridoma growth factor mAb - Research Grade
Uniprot ID P05231
Source CAS: 2948444-06-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference PX-TA2209-100
Note For research use only. Not suitable for human use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a therapeutic antibody that has shown promising results in targeting and neutralizing a specific growth factor known as Hybridoma in various diseases. This biosimilar is a monoclonal antibody that has been developed using advanced biotechnology techniques to mimic the structure and function of the original therapeutic antibody.

Structure of Pacibekitug Biosimilar

Pacibekitug Biosimilar is a recombinant monoclonal antibody that is composed of two identical heavy chains and two identical light chains. The heavy chains are approximately 50 kDa in size and consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains are approximately 25 kDa in size and consist of two constant domains (CL and CL1) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for the specificity and binding affinity of the antibody towards its target.

Mechanism of Action

Pacibekitug Biosimilar works by specifically targeting and binding to the Hybridoma growth factor. This binding prevents the growth factor from binding to its receptors on the surface of cells, thereby inhibiting its signaling and downstream effects. This ultimately leads to the inhibition of cell growth and proliferation, making it an effective therapeutic agent in various diseases where Hybridoma is implicated.

Application of Pacibekitug Biosimilar

Pacibekitug Biosimilar has shown promising results in preclinical studies for the treatment of various diseases, including cancer, autoimmune disorders, and inflammatory diseases. In cancer, Hybridoma has been found to play a crucial role in promoting tumor growth and metastasis. By targeting this growth factor, Pacibekitug Biosimilar has the potential to inhibit tumor growth and improve patient outcomes.

In autoimmune disorders, Hybridoma has been linked to the development of autoantibodies and the destruction of healthy tissues. By neutralizing this growth factor, Pacibekitug Biosimilar can potentially prevent the progression of these diseases and improve patient symptoms.

Moreover, Hybridoma has also been implicated in inflammatory diseases such as rheumatoid arthritis and inflammatory bowel disease. By inhibiting the activity of this growth factor, Pacibekitug Biosimilar has the potential to reduce inflammation and improve patient outcomes.

Research Grade

Pacibekitug Biosimilar is currently in the research stage, with preclinical studies showing promising results. It is being developed as a biosimilar to the original therapeutic antibody, with the aim of providing a more affordable and accessible treatment option for patients. The research grade of this biosimilar ensures that it meets the highest standards of quality, purity, and potency, making it a reliable tool for researchers and scientists in their studies.

Conclusion

In summary, Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade is a promising therapeutic antibody that specifically targets and neutralizes the Hybridoma growth factor. Its unique structure and mechanism of action make it a potential treatment option for various diseases where Hybridoma is implicated. The research grade of this biosimilar ensures its quality and potency, making it a valuable tool for researchers and scientists in their studies. Further clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar in treating diseases.

Pacibekitug Biosimilar - Research Grade in ELISA Assay

Pacibekitug Biosimilar - Research Grade in ELISA Assay

Pacibekitug Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Pacibekitug Biosimilar - Research Grade

SDS-PAGE for Pacibekitug Biosimilar - Research Grade

Pacibekitug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Pacibekitug Biosimilar – Anti-Hybridoma growth factor mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products