Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Desmin Protein (DES)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P17661
Molecular weight:
53.54 kDa

$217.00

50ug + 217 loyalty points
Met1–Leu470
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Desmin Protein (DES)

Product name Desmin Protein (DES)
Uniprot ID P17661
Uniprot link https://www.uniprot.org/uniprot/P17661
Expression system Prokaryotic expression
Sequence MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Molecular weight 53.54 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu470
Reference PX-P4711
Note For research use only
Molecular Constructor
Met1–Leu470
Product name Desmin Protein (DES)
Uniprot ID P17661
Uniprot link https://www.uniprot.org/uniprot/P17661
Expression system Prokaryotic expression
Sequence MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Molecular weight 53.54 kDa
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu470
Reference PX-P4711
Note For research use only
Molecular Constructor
Met1–Leu470

General information on Desmin protein

Desmin is a muscle-specific protein encoded by DES gene in humans. It is a type III intermediate filament whose main role is to integrate the nuclear membrane and the Z disk in skeletal muscle cells also known as sarcomere. In skeletal muscle cells, desmin protein is essential in regulating the architecture of sarcomere. This protein is also located in cardiac and smooth muscle cells. In cardiac muscle cells, desmin is located in the Z-discs and intercalated discs. Desmin protein also is involved in in maintaining an optimal conformation of the nebulette. The latter, also located in the Z-discs of cardiac muscle cells, is essential in regulating the length of actin thin filaments.
Desmin protein consists of a conserved alpha helix rod, a non-alpha helix head which is variable and a carboxy-terminal tail. Similar to other intermediate filaments, desmin protein has no polarity when assembled. The rod region contains parallel alpha coiled coil dimers and three non-heliacal linkers. The head domain which is rich in arginine, serine and aromatic residues is important for dimer-dimer interactions. The carboxy-terminal tail, on the other hand, is responsible for desmin interactions with proteins and organelles within the cell.

Desmin protein is present early in muscle cell development and is often considered as an early marker of muscle tissue. Initially it is presented at low levels but its concentration in the cell increases as the cell is near its terminal development. In cardiac progenitor cells, desmin protein is believed to contribute as a transcriptional regulator of the NKX2-5 gene which is essential for heart formation and development. Desmin protein links mitochondria to sarcomere and is believed to be involved in regulating respiration rate in muscle cells. Desmin protein expression level is upregulated in human heart failure. It has been suggested that this a defense mechanism in attempt to maintain normal sarcomere organization amid the disease.

There are no reviews yet.

Be the first to review “Desmin Protein (DES)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products