Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dog IL21 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Dog
Uniprot ID:
Q6L7I9
Molecular weight:
17.81 kDa

Original price was: $318.00.Current price is: $271.00.

50ug 15% OFF + 271 loyalty points
His18–Ser146 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Dog IL21 Recombinant Protein, C-His

Product name ARO-P20880-100
Uniprot ID Q6L7I9
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS
Molecular weight 17.81 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His18-Ser146
Aliases /Synonyms IL-21, IL21, Interleukin-21, Za11
Reference ARO-P20880
Note For research use only.
Molecular Constructor
His18–Ser146 His
Product name ARO-P20880-1MG
Uniprot ID Q6L7I9
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS
Molecular weight 17.81 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His18-Ser146
Aliases /Synonyms IL-21, IL21, Interleukin-21, Za11
Reference ARO-P20880
Note For research use only.
Molecular Constructor
His18–Ser146 His
Product name ARO-P20880-50
Uniprot ID Q6L7I9
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence HKSSFQEQDLLLIRMRQLIDIVDQLKNYVNDLDPESLPAPEDVKRHCERSAFSCFQKVQLKAANTGGNEQIINVLTKQLKRKLPPTNAGRRQKHRPACPSCDSYEKAPPKEFLERLKSLIQKMIHQHLS
Molecular weight 17.81 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His18-Ser146
Aliases /Synonyms IL-21, IL21, Interleukin-21, Za11
Reference ARO-P20880
Note For research use only.
Molecular Constructor
His18–Ser146 His

There are no reviews yet.

Be the first to review “Dog IL21 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products