Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dog IL4 recombinant protein

Host species:
Mammalian cells
Origin species:
Dog
Uniprot ID:
O77762
Molecular weight:
41.02 kDa

Original price was: $388.00.Current price is: $315.00.

50ug 19% OFF + 315 loyalty points
Asn26–His132 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Dog IL4 recombinant protein

Dog IL4 recombinant protein

Product name PX-P6454-100
Uniprot ID O77762
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence NFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
Molecular weight 41.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn26-His132
Aliases /Synonyms IL-4, B-cell stimulatory factor 1, BSF-1, Lymphocyte stimulatory factor 1, IL4Interleukin-4,
Reference PX-P6454
Molecular Constructor
Asn26–His132 Fc
Product name PX-P6454-1MG
Uniprot ID O77762
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence NFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
Molecular weight 41.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn26-His132
Aliases /Synonyms IL-4, B-cell stimulatory factor 1, BSF-1, Lymphocyte stimulatory factor 1, IL4Interleukin-4,
Reference PX-P6454
Molecular Constructor
Asn26–His132 Fc
Product name PX-P6454-50
Uniprot ID O77762
Origin species Dog
Expression system Eukaryotic expression
Raw Antigen Sequence NFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
Molecular weight 41.02 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn26-His132
Aliases /Synonyms IL-4, B-cell stimulatory factor 1, BSF-1, Lymphocyte stimulatory factor 1, IL4Interleukin-4,
Reference PX-P6454
Molecular Constructor
Asn26–His132 Fc

Dog IL4 recombinant protein

There are no reviews yet.

Be the first to review “Dog IL4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products