Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Flotetuzumab Biosimilar – Anti-CD3E, IL3RA, CD123 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
VH-VL-VH'-VL'

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade

Product name Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody
Product name Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody
Product name PX-TA1456-50
Uniprot ID P26951 & P07766
Source CAS 1664355-28-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Flotetuzumab,MGD-006,MGD006,RES234,S80880,CD3E, IL3RA, CD123,anti-CD3E, IL3RA, CD123
Reference PX-TA1456
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-VL-VH'-VL'
Clonality Monoclonal Antibody

Introduction

Flotetuzumab Biosimilar, also known as Anti-CD3E, IL3RA, CD123 mAb, is a monoclonal antibody that targets three different proteins: CD3E, IL3RA, and CD123. It is currently being developed as a potential therapeutic option for various types of cancer, including acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS). In this article, we will discuss the structure, activity, and potential applications of Flotetuzumab Biosimilar in detail.

Structure of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. It is made up of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody are derived from mouse antibodies, while the constant regions are from human antibodies. This structure allows Flotetuzumab Biosimilar to have a high binding affinity to its target proteins.

Activity of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar works by binding to three different proteins: CD3E, IL3RA, and CD123. CD3E is a protein found on the surface of T cells, while IL3RA and CD123 are proteins found on the surface of leukemic stem cells. By binding to these proteins, Flotetuzumab Biosimilar activates the T cells and directs them to attack and kill the leukemic stem cells. This mechanism of action is different from traditional chemotherapy, which targets all rapidly dividing cells, including healthy cells.

Potential Applications of Flotetuzumab Biosimilar

Flotetuzumab Biosimilar is currently being investigated as a potential treatment for AML and MDS. AML is a type of cancer that affects the blood and bone marrow, while MDS is a group of disorders in which the bone marrow does not produce enough healthy blood cells. Both of these conditions are characterized by the presence of leukemic stem cells, and Flotetuzumab Biosimilar has shown promising results in targeting and killing these cells.

In a phase 1 clinical trial, Flotetuzumab Biosimilar was given to patients with relapsed or refractory AML. The results showed that 33% of patients achieved a complete response, and 17% achieved a complete response with incomplete hematologic recovery. These responses were durable, with a median duration of 12.1 months. In addition, Flotetuzumab Biosimilar was well-tolerated, with manageable side effects.

In another phase 1 clinical trial, Flotetuzumab Biosimilar was given to patients with relapsed or refractory MDS. The results showed that 50% of patients achieved a complete response, and 25% achieved a partial response. These responses were also durable, with a median duration of 8.3 months. Flotetuzumab Biosimilar was well-tolerated in this patient population as well.

Conclusion

In conclusion, Flotetuzumab Biosimilar is a promising therapeutic option for AML and MDS. Its unique mechanism of action, targeting specific proteins on leukemic stem cells, has shown promising results in clinical trials. With further research and development, Flotetuzumab Biosimilar has the potential to become a valuable treatment option for these types of cancer.

SDS-PAGE for Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade

SDS-PAGE for Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade

Flotetuzumab Biosimilar - Anti-CD123;IL-3Rα and CD3E mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flotetuzumab Biosimilar - Anti-CD3E, IL3RA, CD123 mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

Show only reviews in English (1)

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products