Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) HHV2/HSV2 gD/US6 recombinant protein

Host species:
Mammalian cells
Origin species:
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Uniprot ID:
Q69467
Molecular weight:
38.24 kDa

Original price was: $583.00.Current price is: $470.00.

100ug 19% OFF + 470 loyalty points
Met1–Pro339 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) HHV2/HSV2 gD/US6 recombinant protein

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) HHV2/HSV2 gD/US6 recombinant protein

Product name PX-P6426-100
Uniprot ID Q69467
Origin species Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 38.24 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro339
Aliases /Synonyms gD, gD, US6, Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)Envelope glycoprotein D,
Reference PX-P6426
Molecular Constructor
Met1–Pro339 His
Product name PX-P6426-1MG
Uniprot ID Q69467
Origin species Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 38.24 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro339
Aliases /Synonyms gD, gD, US6, Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)Envelope glycoprotein D,
Reference PX-P6426
Molecular Constructor
Met1–Pro339 His
Product name PX-P6426-50
Uniprot ID Q69467
Origin species Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Expression system Eukaryotic expression
Raw Antigen Sequence MGRLTSGVGTAALLVVAVGLRVVCAKYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQDVAPHHAPAAPSNP
Molecular weight 38.24 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro339
Aliases /Synonyms gD, gD, US6, Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)Envelope glycoprotein D,
Reference PX-P6426
Molecular Constructor
Met1–Pro339 His

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) HHV2/HSV2 gD/US6 recombinant protein

There are no reviews yet.

Be the first to review “Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2) HHV2/HSV2 gD/US6 recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products