Brand: ProteoGenix

Human RNAse l Mutant type Recombinant Protein

PX-P2089-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P07998
Molecular weight:: 15.75 kDa

$250.00

50ug + 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $355.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human RNAse l Mutant type Recombinant Protein

Product name	Human RNAse l Mutant type Recombinant Protein
Uniprot ID	P07998
Uniprot link	http://www.uniprot.org/uniprot/P07998
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGKESRAKKFQRQVMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTLEHHHHHH
Molecular weight	15.75 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	NP_002924
Spec:Entrez GeneID	6035
Spec:NCBI Gene Aliases	RIB1, RNS1, RAC1
Spec:SwissProtID	P07998
NCBI Reference	NP_002924
Aliases /Synonyms	RNAse l Mutant type, ribonuclease, RNase A family, 1 (pancreatic)
Reference	PX-P2089
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human RNAse l Mutant type Recombinant Protein
Uniprot ID	P07998
Uniprot link	http://www.uniprot.org/uniprot/P07998
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGKESRAKKFQRQVMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTLEHHHHHH
Molecular weight	15.75 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	NP_002924
Spec:Entrez GeneID	6035
Spec:NCBI Gene Aliases	RIB1, RNS1, RAC1
Spec:SwissProtID	P07998
NCBI Reference	NP_002924
Aliases /Synonyms	RNAse l Mutant type, ribonuclease, RNase A family, 1 (pancreatic)
Reference	PX-P2089
Note	For research use only
Molecular Constructor	Partial Yes

There are no reviews yet.

Be the first to review “Human RNAse l Mutant type Recombinant Protein”

Human RNAse l Mutant type Recombinant Protein

Human RNAse l Mutant type Recombinant Protein

Related products

Panobacumab Biosimilar – Anti-Serotype IATS O12 mAb – Research Grade

Detumomab Biosimilar – Anti-B-cell lymphomas mAb – Research Grade

Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade

Recaticimab Biosimilar – Anti-PCSK9 mAb – Research Grade

SAR113244 Biosimilar – Anti-CXC-R5 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human RNAse l Mutant type Recombinant Protein

Specifications Human RNAse l Mutant type Recombinant Protein

Documents

Reviews

Related products

Panobacumab Biosimilar – Anti-Serotype IATS O12 mAb – Research Grade

Detumomab Biosimilar – Anti-B-cell lymphomas mAb – Research Grade

Pritoxaximab Biosimilar – Anti-shiga toxin type 1 B subunit mAb – Research Grade

Recaticimab Biosimilar – Anti-PCSK9 mAb – Research Grade

SAR113244 Biosimilar – Anti-CXC-R5 mAb – Research Grade

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human RNAse l Mutant type Recombinant Protein