Brand: ProteoGenix

Microtubule-associated protein tau(MAPT)(1-441)

PX-P4601-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: P10636-8

$217.00

50ug + 217 loyalty points

Met1–Leu441

size size

50ug $217.00
100ug $392.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Microtubule-associated protein tau(MAPT)(1-441)

Product name	Microtubule-associated protein tau(MAPT)(1-441)
Uniprot ID	P10636-8
Uniprot link	http://www.uniprot.org/uniprot/P10636-8
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKST PTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVV RTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIV YKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Purity estimated	>80% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Leu441
Aliases /Synonyms	Neurofibrillary tangle protein,Paired helical filament-tau,MAPTL, MTBT1, TAU
Reference	PX-P4601
Note	For research use only
Molecular Constructor	Met1–Leu441

Product name	Microtubule-associated protein tau(MAPT)(1-441)
Uniprot ID	P10636-8
Uniprot link	http://www.uniprot.org/uniprot/P10636-8
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKST PTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVV RTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIV YKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHG AEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Purity estimated	>80% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Leu441
Aliases /Synonyms	Neurofibrillary tangle protein,Paired helical filament-tau,MAPTL, MTBT1, TAU
Reference	PX-P4601
Note	For research use only
Molecular Constructor	Met1–Leu441

General Information about Microtubule-associated protein tau (MAPT)

Microtubule-associated protein tau (MAPT) promotes microtubule assembly and stability, and may participate in the establishment and maintenance of neuronal polarity. The C-terminus binds to axon microtubules, while the N-terminus binds to the plasma membrane components, indicating that tau acts as a linker between the two. Axon polarity is predetermined by the TAU/MAPT positioning (in neuronal cells) in the cell body domain defined by the centrosome. The short isoform can make the cytoskeleton plastic, while the longer isoform can give priority to its stabilizing effect.

There are no reviews yet.

Be the first to review “Microtubule-associated protein tau(MAPT)(1-441)”

Microtubule-associated protein tau(MAPT)(1-441)

Microtubule-associated protein tau(MAPT)(1-441)

General Information about Microtubule-associated protein tau (MAPT)

Related products

Tilavonemab Biosimilar – Anti-MAPT mAb – Research Grade

Gosuranemab Biosimilar – Anti-MAPT mAb – Research Grade

Semorinemab Biosimilar – Anti-MAPT mAb – Research Grade

Zagotenemab Biosimilar – Anti-MAPT mAb – Research Grade

Bepranemab Biosimilar – Anti-MAPT mAb – Research Grade

Posdinemab Biosimilar – Anti-MAPT mAb – Research Grade

SARS-CoV-2 RBD of Spike protein–BA.2.75 – Omicron Variant

Microtubule-associated protein tau(MAPT)(1-441)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Microtubule-associated protein tau(MAPT)(1-441)

Specifications Microtubule-associated protein tau(MAPT)(1-441)

Description

General Information about Microtubule-associated protein tau (MAPT)

Documents

Reviews

Related products

Tilavonemab Biosimilar – Anti-MAPT mAb – Research Grade

Gosuranemab Biosimilar – Anti-MAPT mAb – Research Grade

Semorinemab Biosimilar – Anti-MAPT mAb – Research Grade

Zagotenemab Biosimilar – Anti-MAPT mAb – Research Grade

Bepranemab Biosimilar – Anti-MAPT mAb – Research Grade

Posdinemab Biosimilar – Anti-MAPT mAb – Research Grade

SARS-CoV-2 RBD of Spike protein–BA.2.75 – Omicron Variant

Microtubule-associated protein tau(MAPT)(1-441)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Microtubule-associated protein tau(MAPT)(1-441)