Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

NKX2-1, N-GST, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P43699
Molecular weight:
34.20 kDa

$392.00

100ug + 392 loyalty points
GST Ala40–Pro111
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

NKX2-1, N-GST, recombinant protein

Product name NKX2-1, N-GST, recombinant protein
Uniprot ID P43699
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGP
Molecular weight 34.20 kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Pro111
Protein Accession P43699
Reference PX-P5855
Note For research use only
Molecular Constructor
GST Ala40–Pro111

NKX2-1, N-GST, recombinant protein

There are no reviews yet.

Be the first to review “NKX2-1, N-GST, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products