Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ANO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5XXA6
Molecular weight:
26.90 kDa

Original price was: $462.00.Current price is: $392.00.

100ug 15% OFF + 392 loyalty points
Met117–Gly325
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ANO1 Protein, N-His

Product name ARO-P11368-100
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325
Product name ARO-P11368-1MG
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325
Product name ARO-P11368-50
Uniprot ID Q5XXA6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFG
Molecular weight 26.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met117-Gly325
Aliases /Synonyms Anoctamin-1, Tumor-amplified and overexpressed sequence 2, Transmembrane protein 16A, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, TMEM16A, ANO1, TAOS2, ORAOV2, DOG1
Reference ARO-P11368
Note For research use only.
Molecular Constructor
Met117–Gly325

Introduction to Recombinant Human ANO1 Protein

Recombinant Human ANO1 Protein, also known as Anoctamin-1, is a transmembrane protein that belongs to the Anoctamin family. It is encoded by the ANO1 gene and is expressed in various tissues, including the lungs, gastrointestinal tract, and reproductive organs. ANO1 plays a crucial role in calcium-activated chloride channel activity and is involved in various physiological processes such as cell proliferation, migration, and secretion. In this article, we will discuss the structure, activity, and applications of Recombinant Human ANO1 Protein.

Structure of Recombinant Human ANO1 Protein

The ANO1 gene encodes a protein of 986 amino acids, with a predicted molecular weight of approximately 110 kDa. The protein consists of eight transmembrane domains, with a large intracellular loop between the fifth and sixth transmembrane regions. The intracellular loop contains a conserved Ca2+-binding domain, which is essential for the calcium-activated chloride channel activity of ANO1. The extracellular domain of ANO1 contains several glycosylation sites, which are important for its stability and function.

Activity of Recombinant Human ANO1 Protein

Recombinant Human ANO1 Protein is a calcium-activated chloride channel that is activated by an increase in intracellular calcium levels. The channel is permeable to chloride ions and is responsible for the regulation of chloride transport across the cell membrane. ANO1 is also involved in the regulation of other ion channels, such as the cystic fibrosis transmembrane conductance regulator (CFTR), which plays a crucial role in maintaining the balance of ions and fluids in the body.

In addition to its role as a chloride channel, ANO1 also has other activities. It has been shown to regulate cell proliferation, migration, and secretion in various tissues. ANO1 is overexpressed in several types of cancer, including gastrointestinal, breast, and prostate cancer, and is believed to play a role in tumor growth and metastasis. Therefore, targeting ANO1 with recombinant protein inhibitors has emerged as a potential therapeutic strategy for cancer treatment.

Applications of Recombinant Human ANO1 Protein

Recombinant Human ANO1 Protein has several applications in both research and clinical settings. Its role as a calcium-activated chloride channel makes it a valuable tool for studying chloride transport and its regulation in various tissues. ANO1 inhibitors, such as CaCCinh-A01, are commonly used in research to study the function and activity of ANO1.

In the clinical setting, ANO1 has been identified as a potential therapeutic target for various diseases. As mentioned earlier, ANO1 inhibitors have shown promising results in inhibiting tumor growth and metastasis in cancer. ANO1 has also been implicated in diseases such as asthma, cystic fibrosis, and hypertension, making it a potential target for drug development in these conditions.

Moreover, Recombinant Human ANO1 Protein has also been used in diagnostic tests for certain diseases. ANO1 is a known antigen in autoimmune diseases such as Sjögren’s syndrome, where autoantibodies against ANO1 are present in the serum of patients. Recombinant ANO1 protein can be used in immunoassays to detect these autoantibodies, aiding in the diagnosis of the disease.

Conclusion

In conclusion, Recombinant Human ANO1 Protein is a transmembrane protein that plays a crucial role in calcium-activated chloride channel activity and is involved in various physiological processes. Its structure, activity, and applications make it a valuable tool for research and a potential therapeutic target for various diseases. With ongoing research and development, the potential of ANO1 as a target for drug development and diagnostic tests is continuously expanding.

Recombinant Human ANO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ANO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products