Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CAVIN2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95810
Molecular weight:
15.15 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Glu45–Lys156
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CAVIN2 Protein, N-His

Product name ARO-P12266-100
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156
Product name ARO-P12266-1MG
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156
Product name ARO-P12266-50
Uniprot ID O95810
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFK
Molecular weight 15.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu45-Lys156
Aliases /Synonyms Caveolae-associated protein 2, SDPR, CAVIN2, Serum deprivation-response protein, Cavin-2, PS-p68, Phosphatidylserine-binding protein
Reference ARO-P12266
Note For research use only.
Molecular Constructor
Glu45–Lys156

Introduction to Recombinant Human CAVIN2 Protein

Recombinant Human CAVIN2 Protein, also known as caveolae-associated protein 2, is a protein that plays an important role in the formation and maintenance of caveolae, which are small invaginations in the plasma membrane of cells. This protein is encoded by the CAVIN2 gene and is found in various tissues and cell types, including adipocytes, endothelial cells, and muscle cells.

Structure of Recombinant Human CAVIN2 Protein

The Recombinant Human CAVIN2 Protein is a 49 kDa protein that consists of 443 amino acids. It contains a N-terminal transmembrane domain, a central coiled-coil domain, and a C-terminal domain that is responsible for binding to caveolin-1, another protein involved in caveolae formation. The coiled-coil domain is important for the oligomerization of CAVIN2, which is necessary for its function in caveolae assembly.

Activity of Recombinant Human CAVIN2 Protein

The main function of Recombinant Human CAVIN2 Protein is to regulate the formation and stability of caveolae. It does this by interacting with caveolin-1 and other proteins involved in the formation of these membrane structures. CAVIN2 is also involved in the regulation of lipid metabolism and insulin signaling, which are important processes in the development of metabolic diseases such as obesity and diabetes.

Studies have shown that CAVIN2-deficient mice have reduced levels of caveolae and impaired insulin signaling, leading to insulin resistance and glucose intolerance. On the other hand, overexpression of CAVIN2 has been shown to increase the number and size of caveolae, enhancing insulin signaling and improving glucose tolerance.

Application of Recombinant Human CAVIN2 Protein

Recombinant Human CAVIN2 Protein has a wide range of applications in both basic research and clinical settings. In basic research, it is used to study the structure and function of caveolae and their role in various cellular processes. It is also used to investigate the mechanisms underlying metabolic diseases such as obesity and diabetes, as well as other diseases that involve caveolae dysfunction.

In clinical settings, Recombinant Human CAVIN2 Protein has potential applications in the treatment of metabolic diseases. As mentioned earlier, studies have shown that CAVIN2 plays a crucial role in regulating insulin signaling and glucose metabolism. Therefore, targeting CAVIN2 could be a potential therapeutic strategy for these diseases. Additionally, CAVIN2 has been found to be involved in the development of certain cancers, making it a potential target for cancer therapy.

Conclusion

In summary, Recombinant Human CAVIN2 Protein is a key player in the formation and maintenance of caveolae, with important implications in various cellular processes and diseases. Its structure, activity, and potential applications make it a valuable tool for both basic research and clinical studies. Further research on this protein could lead to a better understanding of caveolae biology and the development of new treatments for metabolic diseases and cancer.

Recombinant Human CAVIN2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CAVIN2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products