Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IGF2BP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZI8
Molecular weight:
21.71 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Val194–Asn369
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IGF2BP1 Protein, N-His

Product name ARO-P12444-100
Uniprot ID Q9NZI8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLN
Molecular weight 21.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val194-Asn369
Aliases /Synonyms VICKZ family member 1, Zipcode-binding protein 1, IGF2BP1, VICKZ1, Coding region determinant-binding protein, IMP1, IMP-1, ZBP1, IGF-II mRNA-binding protein 1, CRDBP, Insulin-like growth factor 2 mRNA-binding protein 1, ZBP-1, CRD-BP, IGF2 mRNA-binding protein 1
Reference ARO-P12444
Note For research use only.
Molecular Constructor
Val194–Asn369
Product name ARO-P12444-1MG
Uniprot ID Q9NZI8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLN
Molecular weight 21.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val194-Asn369
Aliases /Synonyms VICKZ family member 1, Zipcode-binding protein 1, IGF2BP1, VICKZ1, Coding region determinant-binding protein, IMP1, IMP-1, ZBP1, IGF-II mRNA-binding protein 1, CRDBP, Insulin-like growth factor 2 mRNA-binding protein 1, ZBP-1, CRD-BP, IGF2 mRNA-binding protein 1
Reference ARO-P12444
Note For research use only.
Molecular Constructor
Val194–Asn369
Product name ARO-P12444-50
Uniprot ID Q9NZI8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLN
Molecular weight 21.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val194-Asn369
Aliases /Synonyms VICKZ family member 1, Zipcode-binding protein 1, IGF2BP1, VICKZ1, Coding region determinant-binding protein, IMP1, IMP-1, ZBP1, IGF-II mRNA-binding protein 1, CRDBP, Insulin-like growth factor 2 mRNA-binding protein 1, ZBP-1, CRD-BP, IGF2 mRNA-binding protein 1
Reference ARO-P12444
Note For research use only.
Molecular Constructor
Val194–Asn369

Recombinant Human IGF2BP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IGF2BP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products