Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MCM8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UJA3
Molecular weight:
33.26 kDa

Original price was: $374.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Ser90–Lys366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MCM8 Protein, N-His

Product name ARO-P11954-100
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366
Product name ARO-P11954-1MG
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366
Product name ARO-P11954-50
Uniprot ID Q9UJA3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAFLCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEANSISNSK
Molecular weight 33.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser90-Lys366
Aliases /Synonyms MCM8, C20orf154, Minichromosome maintenance 8, DNA helicase MCM8
Reference ARO-P11954
Note For research use only.
Molecular Constructor
Ser90–Lys366

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where DNA fragments are inserted into host cells to produce large quantities of a specific protein. These proteins have a wide range of applications in scientific research, diagnostics, and therapeutics. One such recombinant protein is the human MCM8 protein, which has been extensively studied for its role in DNA replication and repair processes.

Structure of Recombinant Human MCM8 Protein

The human MCM8 protein, also known as minichromosome maintenance complex component 8, is a member of the MCM protein family. It is composed of 849 amino acids and has a molecular weight of approximately 95 kDa. The protein contains a conserved ATPase domain, which is essential for its function in DNA replication. It also has a nuclear localization signal, indicating its role in the nucleus of cells.

Activity of Recombinant Human MCM8 Protein

The primary function of the MCM8 protein is to act as a replicative helicase, which unwinds the double-stranded DNA during DNA replication. This activity is crucial for the accurate and timely duplication of the genetic material in cells. MCM8 has also been shown to play a role in the repair of DNA damage, specifically in the homologous recombination pathway. This protein is involved in the restart of stalled replication forks and the processing of DNA structures during DNA repair processes.

Application of Recombinant Human MCM8 Protein

Recombinant human MCM8 protein has been widely used in various research applications to study its structure, function, and role in DNA replication and repair. It can be used in in vitro assays to study its ATPase activity and DNA unwinding ability. The protein can also be used in protein-protein interaction studies to identify its binding partners and understand the molecular mechanisms of its function.

Moreover, recombinant MCM8 protein has potential diagnostic and therapeutic applications. Mutations in the MCM8 gene have been associated with various human diseases, including cancer and developmental disorders. Therefore, studying the function of this protein can provide insights into disease mechanisms and aid in the development of targeted therapies.

Antigen for Antibody Production

Recombinant human MCM8 protein can also serve as an antigen for the production of specific antibodies. Antibodies against this protein can be used in various immunological assays to detect its expression and localization in different cell types and tissues. These antibodies can also be used to study the effects of MCM8 mutations on its function and to investigate its role in disease development.

Recombinant Protein Production

The production of recombinant human MCM8 protein is achieved through the expression of the MCM8 gene in a suitable host cell, such as E. coli or mammalian cells. The protein is then purified using various techniques, such as affinity chromatography, to obtain a highly pure and active form of the protein. This recombinant protein can be used in various experiments and applications, providing a reliable and consistent source of MCM8 protein.

Conclusion

In summary, recombinant human MCM8 protein is a crucial player in DNA replication and repair processes. Its structure, activity, and application have been extensively studied, providing valuable insights into its function and potential therapeutic applications. With the continuous advancements in genetic engineering techniques, the production of recombinant proteins, including MCM8, will continue to play a significant role in scientific research and medical advancements.

Recombinant Human MCM8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MCM8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products