Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human PABPC4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13310
Molecular weight:
26.62 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Met10–Asp225
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human PABPC4 Protein, N-His

Recombinant Human PABPC4 Protein, N-His

Product name ARO-P11416-100
Uniprot ID Q13310
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met10-Asp225
Aliases /Synonyms Activated-platelet protein 1, APP-1, PABP4, PABPC4, APP1, Inducible poly(A)-binding protein, PABP-4, Polyadenylate-binding protein 4, Poly(A)-binding protein 4, iPABP
Reference ARO-P11416
Note For research use only.
Molecular Constructor
Met10–Asp225
Product name ARO-P11416-1MG
Uniprot ID Q13310
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met10-Asp225
Aliases /Synonyms Activated-platelet protein 1, APP-1, PABP4, PABPC4, APP1, Inducible poly(A)-binding protein, PABP-4, Polyadenylate-binding protein 4, Poly(A)-binding protein 4, iPABP
Reference ARO-P11416
Note For research use only.
Molecular Constructor
Met10–Asp225
Product name ARO-P11416-50
Uniprot ID Q13310
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRD
Molecular weight 26.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met10-Asp225
Aliases /Synonyms Activated-platelet protein 1, APP-1, PABP4, PABPC4, APP1, Inducible poly(A)-binding protein, PABP-4, Polyadenylate-binding protein 4, Poly(A)-binding protein 4, iPABP
Reference ARO-P11416
Note For research use only.
Molecular Constructor
Met10–Asp225

Recombinant Human PABPC4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PABPC4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products