Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PHOX2B Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99453
Molecular weight:
20.02 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Thr106–Gly173
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PHOX2B Protein, N-His-SUMO

Product name ARO-P11410-100
Uniprot ID Q99453
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSG
Molecular weight 20.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr106-Gly173
Aliases /Synonyms PMX2B, PHOX2B homeodomain protein, Paired-like homeobox 2B, Neuroblastoma Phox, Paired mesoderm homeobox protein 2B, NBPhox, PHOX2B
Reference ARO-P11410
Note For research use only.
Molecular Constructor
Thr106–Gly173
Product name ARO-P11410-1MG
Uniprot ID Q99453
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSG
Molecular weight 20.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr106-Gly173
Aliases /Synonyms PMX2B, PHOX2B homeodomain protein, Paired-like homeobox 2B, Neuroblastoma Phox, Paired mesoderm homeobox protein 2B, NBPhox, PHOX2B
Reference ARO-P11410
Note For research use only.
Molecular Constructor
Thr106–Gly173
Product name ARO-P11410-50
Uniprot ID Q99453
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSG
Molecular weight 20.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr106-Gly173
Aliases /Synonyms PMX2B, PHOX2B homeodomain protein, Paired-like homeobox 2B, Neuroblastoma Phox, Paired mesoderm homeobox protein 2B, NBPhox, PHOX2B
Reference ARO-P11410
Note For research use only.
Molecular Constructor
Thr106–Gly173

Introduction

Recombinant Human PHOX2B protein is a crucial protein involved in the development and function of the nervous system. It belongs to the PHOX2 family of transcription factors and plays a vital role in the regulation of gene expression during embryonic development. In this article, we will discuss the structure, activity, and applications of Recombinant Human PHOX2B protein.

Structure of Recombinant Human PHOX2B Protein

The human PHOX2B gene is located on chromosome 4 and encodes for a protein of 314 amino acids. The protein consists of two functional domains, a DNA-binding domain (DBD) and a transactivation domain (TAD). The DBD is responsible for binding to specific DNA sequences, while the TAD interacts with other proteins to regulate gene expression.

The crystal structure of the DBD of PHOX2B has been determined, revealing a helix-turn-helix motif that is characteristic of transcription factors. This domain is highly conserved among different species, indicating its critical role in the function of PHOX2B protein.

Activity of Recombinant Human PHOX2B Protein

Recombinant Human PHOX2B protein has been shown to have transcriptional activity, meaning it can bind to specific DNA sequences and regulate the expression of target genes. It has been found to regulate the expression of genes involved in the development and function of the nervous system, such as those encoding for neurotransmitters, ion channels, and other transcription factors.

PHOX2B is also involved in the development of the autonomic nervous system, which controls involuntary functions such as breathing, heart rate, and digestion. Mutations in the PHOX2B gene have been linked to congenital central hypoventilation syndrome (CCHS), a rare disorder characterized by abnormal control of breathing.

Applications of Recombinant Human PHOX2B Protein

1. Research tool

Recombinant Human PHOX2B protein has been widely used as a research tool to study its role in the development and function of the nervous system. It can be used to investigate the binding sites and target genes of PHOX2B, as well as its interactions with other proteins.

2. Diagnostic marker

Mutations in the PHOX2B gene have been linked to CCHS, making it a potential diagnostic marker for this disorder. Recombinant Human PHOX2B protein can be used in diagnostic tests to detect mutations in the gene and aid in the diagnosis of CCHS.

3. Therapeutic target

As PHOX2B is involved in the development and function of the nervous system, it is a potential therapeutic target for neurological disorders. Recombinant Human PHOX2B protein can be used to screen for drugs that can modulate its activity and potentially treat diseases such as CCHS.

4. Vaccine development

Recombinant Human PHOX2B protein has also been explored as a potential antigen for vaccine development. It has been shown to elicit an immune response in animal models, making it a promising candidate for vaccines targeting neurological disorders.

Conclusion

Recombinant Human PHOX2B protein is a crucial transcription factor involved in the development and function of the nervous system. Its structure, activity, and applications make it a valuable tool for research and a potential target for therapeutic interventions. Further studies on this protein may provide new insights into the mechanisms underlying neurological disorders and lead to the development of novel treatments.

Recombinant Human PHOX2B Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human PHOX2B Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products