Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RARRES2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99969
Molecular weight:
16.93 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Ala33–Lys158
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RARRES2, N-His

Product name ARO-P13144-100
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158
Product name ARO-P13144-1MG
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158
Product name ARO-P13144-50
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158

Title: Understanding Recombinant Human RARRES2: Structure, Activity, and Applications

Introduction:
Recombinant Human RARRES2, also known as Retinoic Acid Receptor Responder Protein 2, is a protein that plays a crucial role in various physiological processes, including cell growth, differentiation, and inflammation. This protein is encoded by the RARRES2 gene and is a member of the chemerin family of proteins. In this article, we will delve into the structure, activity, and applications of Recombinant Human RARRES2.

Structure:
Recombinant Human RARRES2 is a 16-kDa protein that consists of 154 amino acids. It is composed of four distinct domains: an N-terminal signal peptide, a propeptide, a chemerin domain, and a C-terminal domain. The chemerin domain is the most conserved region and is responsible for the biological activity of RARRES2. The C-terminal domain is highly variable and is involved in binding to different receptors, leading to diverse biological functions.

Activity:
RARRES2 is primarily known for its role in regulating adipogenesis and inflammation. It is secreted as an inactive precursor and is activated by proteolytic cleavage by proteases such as elastase and cathepsin G. The active form of RARRES2, known as chemerin, has been shown to have chemotactic activity towards immune cells such as dendritic cells, macrophages, and natural killer cells. It also acts as a chemoattractant for adipocytes, promoting their differentiation and adipogenesis.

RARRES2 has also been found to have anti-inflammatory properties by inhibiting the production of pro-inflammatory cytokines such as TNF-α and IL-6. It also plays a role in wound healing by promoting the migration and proliferation of fibroblasts. Moreover, RARRES2 has been shown to regulate angiogenesis, the process of forming new blood vessels, by promoting the migration and tube formation of endothelial cells.

Applications:
The unique structure and diverse biological activities of RARRES2 make it a promising candidate for various applications in the field of medicine. One of the major applications of Recombinant Human RARRES2 is in the treatment of obesity and related metabolic disorders. Studies have shown that RARRES2 is involved in regulating adipogenesis and can potentially be used as a therapeutic target for obesity.

Another potential application of RARRES2 is in the treatment of inflammatory diseases. The anti-inflammatory properties of RARRES2 make it a potential candidate for the treatment of diseases such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. Additionally, RARRES2 has been shown to have a role in wound healing, making it a potential therapy for chronic wounds.

Moreover, RARRES2 has been studied in the context of cancer. It has been found to be involved in the regulation of cell proliferation and differentiation, making it a potential target for cancer therapy. Furthermore, RARRES2 has been shown to inhibit the growth and metastasis of certain types of cancer cells, making it a promising candidate for cancer treatment.

Conclusion:
In conclusion, Recombinant Human RARRES2 is a protein with a unique structure and diverse biological activities. It plays a crucial role in regulating adipogenesis, inflammation, wound healing, and angiogenesis. Its potential applications in the treatment of obesity, inflammatory diseases, and cancer make it a promising candidate for further research and development. With ongoing studies and advancements in protein engineering, the potential of RARRES2 in the field of medicine is yet to be fully explored.

Recombinant Human RARRES2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RARRES2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products