Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WAS Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P42768
Molecular weight:
38.54 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Gly40–Glu131
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WAS Protein, N-GST & C-His

Product name ARO-P10777-100
Uniprot ID P42768
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADE
Molecular weight 38.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly40-Glu131
Aliases /Synonyms WASp, WAS, Wiskott-Aldrich syndrome protein, IMD2
Reference ARO-P10777
Note For research use only.
Molecular Constructor
Gly40–Glu131
Product name ARO-P10777-1MG
Uniprot ID P42768
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADE
Molecular weight 38.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly40-Glu131
Aliases /Synonyms WASp, WAS, Wiskott-Aldrich syndrome protein, IMD2
Reference ARO-P10777
Note For research use only.
Molecular Constructor
Gly40–Glu131
Product name ARO-P10777-50
Uniprot ID P42768
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADE
Molecular weight 38.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly40-Glu131
Aliases /Synonyms WASp, WAS, Wiskott-Aldrich syndrome protein, IMD2
Reference ARO-P10777
Note For research use only.
Molecular Constructor
Gly40–Glu131

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics and therapeutics. These proteins are produced by genetic engineering techniques, where the DNA sequence encoding for a particular protein is inserted into a host cell, allowing for large-scale production of the desired protein. One such recombinant protein is the Recombinant Human WAS Protein, which has gained significant attention for its structural and functional properties.

Structure of Recombinant Human WAS Protein

The Recombinant Human WAS Protein, also known as Wiskott-Aldrich syndrome protein, is a cytoplasmic protein that plays a crucial role in the regulation of actin cytoskeleton. It is encoded by the WAS gene located on the X chromosome. The protein is composed of 502 amino acids and has a molecular weight of approximately 55 kDa. It consists of multiple domains, including an N-terminal WH1 domain, a central proline-rich region, and a C-terminal verprolin homology, cofilin homology, and acidic (VCA) domain. These domains are responsible for the protein’s interaction with other proteins and its role in actin polymerization.

Activity of Recombinant Human WAS Protein

The primary function of Recombinant Human WAS Protein is to regulate the actin cytoskeleton, which is essential for various cellular processes such as cell shape, movement, and division. It does so by binding to actin monomers and promoting their polymerization into filaments. The WH1 domain of the protein binds to the proline-rich region of the WIP (WASP-interacting protein), which in turn binds to the actin monomers. This interaction leads to the activation of the VCA domain, which promotes actin polymerization. Additionally, the protein also interacts with various other proteins, including actin-binding proteins and signaling molecules, to regulate actin dynamics and cell motility.

Applications of Recombinant Human WAS Protein

Due to its crucial role in actin regulation, Recombinant Human WAS Protein has several applications in research, diagnostics, and therapeutics.

Research

The protein is widely used in research to study the mechanisms of actin dynamics and its role in various cellular processes. It is also used to investigate the pathophysiology of Wiskott-Aldrich syndrome, a rare genetic disorder caused by mutations in the WAS gene, which leads to a deficiency of the WAS protein.

Diagnostics

Defects in the WAS gene and subsequent deficiency of the WAS protein can result in Wiskott-Aldrich syndrome, which is characterized by immune system dysfunction, eczema, and low platelet counts. Recombinant Human WAS Protein is used in diagnostic tests to detect mutations in the WAS gene and diagnose this syndrome.

Therapeutics

Recombinant Human WAS Protein has shown potential as a therapeutic agent for Wiskott-Aldrich syndrome. Studies have demonstrated that the protein can improve platelet function and immune system function in patients with this syndrome. Additionally, it has also been investigated as a potential treatment for other disorders involving actin dysregulation, such as cancer and autoimmune diseases.

Conclusion

In summary, Recombinant Human WAS Protein is a crucial protein involved in the regulation of actin cytoskeleton. Its structural and functional properties make it a valuable tool in various fields of research, diagnostics, and therapeutics. With ongoing research and advancements in genetic engineering techniques, the potential of this protein in various applications is continuously expanding.

Recombinant Human WAS Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human WAS Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products