Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q3U497
Molecular weight:
44.22 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Ser17–Tyr157
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

Product name ARO-P10551-100
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157
Product name ARO-P10551-1MG
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157
Product name ARO-P10551-50
Uniprot ID Q3U497
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYY
Molecular weight 44.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser17-Tyr157
Aliases /Synonyms IREM-3, CLM-7, Leukocyte mono-Ig-like receptor 5, CD300b, Immune receptor expressed on myeloid cells 3, CD300LB, CD300B, Triggering receptor expressed on myeloid cells 5, CMRF35-like molecule 7, LMIR5, CMRF35A2, IREM3, CD300 antigen-like family member B, CMRF35-A2, TREM-5, TREM5, CLM7
Reference ARO-P10551
Note For research use only.
Molecular Constructor
Ser17–Tyr157

Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD300b/CD300LB Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products