Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD62L/SELL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P18337
Molecular weight:
33.67 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Thr40–Thr319
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD62L/SELL Protein, N-His

Product name ARO-P10603-100
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319
Product name ARO-P10603-1MG
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319
Product name ARO-P10603-50
Uniprot ID P18337
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQET
Molecular weight 33.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Thr319
Aliases /Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1, CD62L, LYAM1, TQ1, SELL, Leukocyte-endothelial cell adhesion molecule 1, L-selectin, LAM-1, gp90-MEL, LNHR, LECAM1, Lymph node homing receptor, Leukocyte surface antigen Leu-8
Reference ARO-P10603
Note For research use only.
Molecular Constructor
Thr40–Thr319

Introduction

Recombinant proteins have become an essential tool in various fields of research and medicine. These proteins are produced through genetic engineering techniques, where the DNA sequence encoding for a specific protein is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein. One such important recombinant protein is the Recombinant Mouse CD62L/SELL Protein.

Structure of Recombinant Mouse CD62L/SELL Protein

The Recombinant Mouse CD62L/SELL Protein, also known as L-selectin, is a glycoprotein that belongs to the selectin family of adhesion molecules. It is composed of 372 amino acids and has a molecular weight of approximately 40 kDa. The protein has a complex structure, consisting of an N-terminal lectin-like domain, an epidermal growth factor-like domain, and two C-type lectin-like domains. These domains are responsible for the binding of the protein to its ligands and mediating cell adhesion.

The lectin-like domain of the protein contains a calcium-dependent carbohydrate recognition site, which allows the protein to bind to specific carbohydrates on the surface of cells. The epidermal growth factor-like domain is involved in protein-protein interactions, while the C-type lectin-like domains are responsible for binding to sulfated carbohydrates. These structural features make the Recombinant Mouse CD62L/SELL Protein highly specific and efficient in its function.

Activity of Recombinant Mouse CD62L/SELL Protein

The main function of the Recombinant Mouse CD62L/SELL Protein is to mediate the adhesion of leukocytes, specifically lymphocytes, to the endothelial cells of blood vessels. This process is crucial for the migration of immune cells from the bloodstream to the site of infection or inflammation. The protein achieves this by binding to its ligands, such as GlyCAM-1 and MAdCAM-1, which are expressed on the surface of endothelial cells.

In addition to its role in leukocyte adhesion, the Recombinant Mouse CD62L/SELL Protein also plays a crucial role in lymphocyte homing and trafficking. It acts as a homing receptor, guiding lymphocytes to specific tissues and organs, such as lymph nodes, through its interaction with peripheral lymph node addressin (PNAd). This function is essential for the proper functioning of the immune system.

Application of Recombinant Mouse CD62L/SELL Protein

The Recombinant Mouse CD62L/SELL Protein has numerous applications in both research and medicine. In research, it is commonly used as an antigen in studies involving cell adhesion, immune cell migration, and lymphocyte homing. The protein can also be used to study the role of selectins in various diseases, such as inflammation, cancer, and autoimmune disorders.

In medicine, the Recombinant Mouse CD62L/SELL Protein has potential therapeutic applications. It can be used as a target for drug development, particularly in the treatment of inflammatory diseases. In addition, the protein can also be used as a biomarker for certain diseases, as its expression is altered in various pathological conditions.

Conclusion

The Recombinant Mouse CD62L/SELL Protein is a crucial protein in the immune system, playing a vital role in leukocyte adhesion, homing, and trafficking. Its complex structure and specific binding properties make it a valuable tool in research and a potential therapeutic target in medicine. With its diverse applications, this recombinant protein continues to contribute to our understanding of immune cell function and its role in disease.

Recombinant Mouse CD62L/SELL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD62L/SELL Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products