Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

S. pombe Swi6 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
S. pombe
Uniprot ID:
P40381
Molecular weight:
38,62 kDa

Original price was: $361.00.Current price is: $308.00.

50ug 15% OFF + 308 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

S. pombe Swi6 Recombinant Protein

Product name S. pombe Swi6 Recombinant Protein
Uniprot ID P40381
Uniprot link http://www.uniprot.org/uniprot/P40381
Origin species S. pombe
Expression system Prokaryotic expression
Raw Antigen Sequence MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE
Molecular weight 38,62 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_593449.1
Spec:Entrez GeneID 2541633
Spec:NCBI Gene Aliases SPAC824.10c
Spec:SwissProtID P40381
NCBI Reference NP_593449.1
Aliases /Synonyms Swi6, chromodomain protein Swi6
Reference PX-P1157
Note For research use only
Molecular Constructor
Full-length Yes
Product name S. pombe Swi6 Recombinant Protein
Uniprot ID P40381
Uniprot link http://www.uniprot.org/uniprot/P40381
Origin species S. pombe
Expression system Prokaryotic expression
Raw Antigen Sequence MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE
Molecular weight 38,62 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_593449.1
Spec:Entrez GeneID 2541633
Spec:NCBI Gene Aliases SPAC824.10c
Spec:SwissProtID P40381
NCBI Reference NP_593449.1
Aliases /Synonyms Swi6, chromodomain protein Swi6
Reference PX-P1157
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1157-1MG
Uniprot ID P40381
Uniprot link http://www.uniprot.org/uniprot/P40381
Origin species S. pombe
Expression system Prokaryotic expression
Raw Antigen Sequence MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE
Molecular weight 38,62 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_593449.1
Spec:Entrez GeneID 2541633
Spec:NCBI Gene Aliases SPAC824.10c
Spec:SwissProtID P40381
NCBI Reference NP_593449.1
Aliases /Synonyms Swi6, chromodomain protein Swi6
Reference PX-P1157
Note For research use only
Molecular Constructor
Full-length Yes

S. pombe Swi6 Recombinant Protein

There are no reviews yet.

Be the first to review “S. pombe Swi6 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products