Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Insect |
Applications | Elisa, WB |
Product name | VSVG Protein- Drosophila VSVG NJ Recombinant Protein |
---|---|
Uniprot ID | P15425 |
Uniprot link | http://www.uniprot.org/uniprot/P15425 |
Origin species | Drosophila |
Expression system | Eukaryotic expression |
Sequence | MLSYLILAIVVSPILGKIEIVFPQHTTGDWKRVPHEYNYCPTSADKNSHGTQTGIPVELTMPKGLTTHQVDGFMCHSALW MTTCDFRWYGPKYITHSIHNEEPTDYQCLEAIKAYKDGVSFNPGFPPQSCGYGTVTDAEAHIITVTPHSVKVDEYTGEWI DPHFIGGRCKGKICETVHNSTKWFTSSDGESVCSQLFTIVGGTFFSDSEEITSMGLPETGIRSNYFPYISTEGICKMPFC RKPGYKLKNDLWFQITDPDLDKKVRDLPHIKDCDLSSSIITPGEHATDISLISDVERILDYALCQSTWSKIEAGEPVTPV DLSYLGPKNPGVGPVFTIINGSLHYFTSKYLRVELESPVIPRMEGKVAGTRIVRQLWDQWFPFGEAEIGPNGVLKTKQGY KFPLHIIGTGEVDSDIKMERTVKHWEHPHIEAAQTYLKKDDTEEVIYYGDTGVSKNPVELVEGWFSGWRSSIMGVVAVIF GFVILILLIRLIGVLSSLFRPKKRPIYKSDVEMAHFRGGHNHRHKH |
Molecular weight | 59.11kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Insect |
Fragment Type | Full-length |
Protein Accession | NP_476656.1 |
Spec:Entrez GeneID | 33271 |
Spec:NCBI Gene Aliases | CG3966, NINAA, DmelCG3966, ninA, NinaA |
Spec:SwissProtID | P15425 |
NCBI Reference | NP_476656.1 |
Aliases /Synonyms | VSVG, neither inactivation nor afterpotential A, Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme, PPIase, Rotamase |
Reference | PX-P2099 |
Note | For research use only |
Vesicular stomatitis virus (VSV) glycoproteins mediate both cell attachment and membrane fusion. Unlike many other low-pH-induced viral fusion proteins, their fusogenic conformational transitions is reversible. VSV-G has a three-stage fusion kinetics:
I. G-protein conformational change which is reversible and pH-dependent.
II. Reversible trimerization and clustering of the G-protein fusion loops.
III. Folding back of a cluster of extended trimers into their post-fusion conformations.
VSV NJ glycoprotein contains 517 amino acids and is glycosylated at position 178 and 335. Unlike VSV Indiana (VSIV), another major serotype of VSV, VSV NJ is not acylated. The two serotypes also differentiate in terms of antigenic structure. VSV NJ has a faster glycoprotein folding intracellularly and with less dependence on glycosylation.
Related products
Send us a message from the form below
Reviews
There are no reviews yet.