Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xentuzumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade

  • PX-TA1409-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade

Product name Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb - Research Grade
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1409-50
Uniprot ID P05019 & P01344
Source CAS 1417158-65-6
Species Homo sapiens
Raw Antigen Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Xentuzumab,BI 836845,IGF1, IGF2 ,anti-IGF1, IGF2
Reference PX-TA1409
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

General information on Anti-IGF1/IGF2 [Homo sapiens] (Xentuzumab) Monoclonal Antibody

Xentuzumab is investigated for the treatment of Epidermal Growth Factor Receptor (EGFR) Mutant Non-small Cell Lung Cancer (NSCLC).

SDS-PAGE for Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb

SDS-PAGE for Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb

Xentuzumab Biosimilar - Anti-IGF1, IGF2 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade in ELISA Assay

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade in ELISA Assay

Xentuzumab Biosimilar - Anti-IGF1 and IGF2 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Xentuzumab Biosimilar - Anti-IGF1, IGF2  mAb - Research Grade

There are no reviews yet.

Be the first to review “Xentuzumab Biosimilar – Anti-IGF1, IGF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products