Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade

  • PX-TA2190-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade

Product name PX-TA2190-50
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody
Product name Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody
Product name Zubotamig Biosimilar - Anti-VTCN1;CD3e mAb - Research Grade
Uniprot ID Q7Z7D3 & P07766
Source Bispecific, CAS: 2640279-10-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference PX-TA2190-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1_L-kappa)_(H-gamma1_Llambda2)
Clonality Monoclonal Antibody

Introduction

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb is a therapeutic antibody that targets the VTCN1 and CD3e proteins. This biosimilar is a research grade product that has been developed for use in various scientific studies and experiments. In this article, we will provide a detailed description of the structure, activity, and potential applications of Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb.

Structure of Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb is a monoclonal antibody that is produced using recombinant DNA technology. It is a humanized antibody, meaning that it contains both human and mouse components. The antibody consists of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy and light chains contain variable regions that are responsible for binding to the target proteins, VTCN1 and CD3e.

Activity of Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb is designed to specifically target the VTCN1 and CD3e proteins. VTCN1, also known as B7-H4, is a protein that is expressed on the surface of tumor cells and plays a role in immune evasion. CD3e is a protein that is found on T cells and is involved in T cell activation. By binding to these proteins, Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb can potentially block the immune evasion mechanisms of cancer cells and activate T cells to attack the tumor.

Mechanism of action

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb works by binding to VTCN1 and CD3e on the surface of cancer cells and T cells, respectively. This binding triggers a series of events that lead to the activation of T cells and the destruction of cancer cells. Additionally, the antibody can also block the interaction between VTCN1 and its receptor on T cells, which is necessary for immune evasion.

Potential Applications

Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb has potential applications in both cancer therapy and immunology research. In cancer therapy, the antibody can be used as a targeted therapy to treat tumors that express high levels of VTCN1. It can also be used in combination with other cancer treatments to enhance their efficacy. In immunology research, Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb can be used to study the role of VTCN1 and CD3e in immune evasion and T cell activation.

Advantages of Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb

Compared to other therapeutic antibodies, Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb has several advantages. Its humanized structure reduces the risk of immune reactions and increases its half-life in the body. Additionally, its specific targeting of VTCN1 and CD3e minimizes potential side effects and increases its efficacy.

Conclusion

In summary, Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb is a research grade therapeutic antibody that targets the VTCN1 and CD3e proteins. Its unique structure and mechanism of action make it a promising candidate for cancer therapy and immunology research. Further studies and clinical trials are needed to fully evaluate its potential in treating cancer and other diseases.

SDS-PAGE for Zubotamig Biosimilar - Research Grade

SDS-PAGE for Zubotamig Biosimilar - Research Grade

Zubotamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Zubotamig Biosimilar - Research Grade in ELISA Assay

Zubotamig Biosimilar - Research Grade in ELISA Assay

Zubotamig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Zubotamig Biosimilar – Anti-VTCN1;CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products