Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

  • ARO-A10693-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG2a, kappa
Clone Name:
SAA0415

Original price was: $507.00.Current price is: $370.00.

50ug 27% OFF + 370 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Product name ARO-A10693-100
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415
Product name ARO-A10693-1MG
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415
Product name ARO-A10693-50
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference ARO-A10693
Note For research use only.
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Target TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Clone Name SAA0415

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Flow Cytometry results for Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE

Flow-cytometry using PE anti-human TNFa antibody. 293T transfected cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human TNFa monoclonal antibody (Catalog ARO-A10693, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “Anti-Human TNFa/TNF-alpha Antibody (SAA0415), PE”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products