Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ELAPOR1 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6UXG2
Molecular weight:
23.95 kDa

Original price was: $331.00.Current price is: $271.00.

50ug 18% OFF + 271 loyalty points
His Asp657–Leu858
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ELAPOR1 Recombinant Protein, N-His

Product name ARO-P20152-100
Uniprot ID Q6UXG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGTCDGCNFHFLWESAAACPL
Molecular weight 23.95 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp657-Leu858
Aliases /Synonyms EIG121, ELAPOR1, Endosome/lysosome-associated apoptosis and autophagy regulator 1, Estrogen-induced gene 121 protein, KIAA1324
Reference ARO-P20152
Note For research use only.
Molecular Constructor
His Asp657–Leu858
Product name ARO-P20152-1MG
Uniprot ID Q6UXG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGTCDGCNFHFLWESAAACPL
Molecular weight 23.95 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp657-Leu858
Aliases /Synonyms EIG121, ELAPOR1, Endosome/lysosome-associated apoptosis and autophagy regulator 1, Estrogen-induced gene 121 protein, KIAA1324
Reference ARO-P20152
Note For research use only.
Molecular Constructor
His Asp657–Leu858
Product name ARO-P20152-50
Uniprot ID Q6UXG2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCTFSRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGTCDGCNFHFLWESAAACPL
Molecular weight 23.95 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp657-Leu858
Aliases /Synonyms EIG121, ELAPOR1, Endosome/lysosome-associated apoptosis and autophagy regulator 1, Estrogen-induced gene 121 protein, KIAA1324
Reference ARO-P20152
Note For research use only.
Molecular Constructor
His Asp657–Leu858

There are no reviews yet.

Be the first to review “Human ELAPOR1 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products