Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Inhibin alpha chain
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Inhibin alpha chain |
|---|---|
| Uniprot ID | P05111 |
| Uniprot link | https://www.uniprot.org/uniprot/P05111 |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI |
| Molecular weight | 16.35kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >80% by SDS-PAGE |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser233-Ile366 |
| Protein Accession | P05111 |
| Spec:Entrez GeneID | 3623 |
| Spec:SwissProtID | A8K8H5 |
| NCBI Reference | P05111 |
| Aliases /Synonyms | A-inhibin subunit; INHA; Inhibin A; inhibin alpha chain; inhibin, alpha |
| Reference | PX-P4882 |
| Note | For research use only |
Related products
Biosimilar
Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1219 238$
Biosimilar
Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1272 238$
Biosimilar
Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1362 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.