Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DLG3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92796
Molecular weight:
22.68 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
His Ala627–Glu802
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DLG3 Protein, N-His

Product name ARO-P15306-100
Uniprot ID Q92796
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIE
Molecular weight 22.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala627-Glu802
Aliases /Synonyms SAP102, Synapse-associated protein 102, Neuroendocrine-DLG, KIAA1232, DLG3, SAP-102, XLMR, Disks large homolog 3
Reference ARO-P15306
Note For research use only.
Molecular Constructor
His Ala627–Glu802
Product name ARO-P15306-1MG
Uniprot ID Q92796
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIE
Molecular weight 22.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala627-Glu802
Aliases /Synonyms SAP102, Synapse-associated protein 102, Neuroendocrine-DLG, KIAA1232, DLG3, SAP-102, XLMR, Disks large homolog 3
Reference ARO-P15306
Note For research use only.
Molecular Constructor
His Ala627–Glu802
Product name ARO-P15306-50
Uniprot ID Q92796
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIE
Molecular weight 22.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala627-Glu802
Aliases /Synonyms SAP102, Synapse-associated protein 102, Neuroendocrine-DLG, KIAA1232, DLG3, SAP-102, XLMR, Disks large homolog 3
Reference ARO-P15306
Note For research use only.
Molecular Constructor
His Ala627–Glu802

There are no reviews yet.

Be the first to review “Recombinant Human DLG3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products