Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HLA-F Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P30511
Molecular weight:
34.92 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Gly22–Pro304
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HLA-F Protein, N-His

Product name ARO-P12226-100
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304
Product name ARO-P12226-1MG
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304
Product name ARO-P12226-50
Uniprot ID P30511
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIP
Molecular weight 34.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly22-Pro304
Aliases /Synonyms Leukocyte antigen F, CDA12, MHC class I antigen F, HLA F antigen, HLA-F, HLAF, HLA class I histocompatibility antigen, alpha chain F, HLA-5.4
Reference ARO-P12226
Note For research use only.
Molecular Constructor
Gly22–Pro304

Introduction
Recombinant human HLA-F protein is a type I transmembrane glycoprotein that belongs to the major histocompatibility complex (MHC) class I family. It is encoded by the HLA-F gene and is expressed on the surface of various cells, including immune cells, endothelial cells, and trophoblasts. HLA-F plays a crucial role in immune surveillance and regulation by presenting antigenic peptides to T cells and interacting with natural killer (NK) cells. In this article, we will discuss the structure, activity, and applications of recombinant human HLA-F protein.

Structure of Recombinant Human HLA-F Protein
The recombinant human HLA-F protein is a heterodimer consisting of an alpha chain and a beta-2 microglobulin (β2m) chain. The alpha chain is composed of three extracellular domains (α1, α2, and α3), a transmembrane domain, and a cytoplasmic tail. The α1 and α2 domains form the peptide-binding groove, while the α3 domain interacts with the T cell receptor. The β2m chain is a small protein that stabilizes the α chain and is required for proper folding and surface expression of HLA-F.

Activity of Recombinant Human HLA-F Protein
HLA-F is a non-classical MHC class I molecule, which means it does not present peptides derived from intracellular proteins like classical MHC class I molecules do. Instead, HLA-F presents peptides derived from exogenous sources, such as viruses or bacteria, to T cells. This process is known as cross-presentation and is essential for the activation of CD8+ T cells, which play a crucial role in the adaptive immune response.

In addition to its role in antigen presentation, HLA-F also interacts with NK cells through its binding to the inhibitory receptor, KIR3DL2. This interaction results in the inhibition of NK cell activity, preventing them from attacking healthy cells. This mechanism is important for maintaining immune tolerance and preventing autoimmune diseases.

Applications of Recombinant Human HLA-F Protein
Recombinant human HLA-F protein has various applications in both research and clinical settings. One of the main uses of recombinant HLA-F is in studying the antigen presentation pathway. By producing recombinant HLA-F in vitro, researchers can study its structure and function, as well as its interactions with T cells and NK cells. This can provide valuable insights into the immune response and the development of new therapies for immune-related diseases.

Another application of recombinant HLA-F is in the development of vaccines. By understanding how HLA-F presents exogenous peptides to T cells, researchers can design vaccines that target specific pathogens and elicit a strong immune response. This is particularly important for developing vaccines against viruses and bacteria that have evolved mechanisms to evade classical MHC class I presentation.

Moreover, recombinant HLA-F has potential clinical applications in the treatment of autoimmune diseases and cancer. As HLA-F plays a critical role in immune tolerance, manipulating its activity could help in treating autoimmune diseases, where the immune system attacks healthy cells. In cancer, HLA-F could be targeted to enhance the immune response against tumor cells, leading to improved outcomes for cancer patients.

Conclusion
Recombinant human HLA-F protein is a crucial component of the immune system, involved in antigen presentation and immune regulation. Its structure and activity make it an essential molecule in the fight against pathogens and the development of new therapies for immune-related diseases. With its wide range of applications, recombinant HLA-F continues to be a valuable tool in scientific research and holds great potential for clinical use in the future.

Recombinant Human HLA-F Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human HLA-F Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products