Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD58 protein(CD58) H146Y

Host species:
Mammalian cells
Uniprot ID:
P19256
Molecular weight:
25.19KDa(40kDa)

$250.00

50ug + 250 loyalty points
Met1~Arg215
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD58 protein(CD58) H146Y

Product name CD58 protein(CD58) H146Y
Uniprot ID P19256
Uniprot link http://www.uniprot.org/uniprot/P19256
Expression system Eukaryotic expression
Raw Antigen Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight 25.19KDa(40kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg215
Aliases /Synonyms LFA3,Ag3,Surface glycoprotein LFA-3,CD58
Reference PX-P4548
Note For research use only
Molecular Constructor
Met1~Arg215
Product name CD58 protein(CD58) H146Y
Uniprot ID P19256
Uniprot link http://www.uniprot.org/uniprot/P19256
Expression system Eukaryotic expression
Raw Antigen Sequence MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight 25.19KDa(40kDa)
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Arg215
Aliases /Synonyms LFA3,Ag3,Surface glycoprotein LFA-3,CD58
Reference PX-P4548
Note For research use only
Molecular Constructor
Met1~Arg215

General Information about CD58 protein (CD58)

Neural cell adhesion molecule (NCAM, which is also a cluster of differentiated CD56) is a homotypic binding glycoprotein expressed on the surface of neurons, glial, skeletal muscle and natural killer cells. NCAM is believed to play a role in cell adhesion, neurite outgrowth, synaptic plasticity, and learning and memory.

There are no reviews yet.

Be the first to review “CD58 protein(CD58) H146Y”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products