Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD3 Antibody (SP34)

Original price was: $347.00.Current price is: $284.00.

50ug 18% OFF + 284 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD3 Antibody (SP34)

Product name ARO-A15465-100
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15465-1MG
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15465-50
Uniprot ID P07766
Raw Antigen Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form 0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Reference ARO-A15465
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3
Clone Name SP34
Protein Name CD3
Target species Anti-Human Monoclonal Antibody

Introduction

The Anti-Human CD3 Antibody (SP34) is a monoclonal antibody that specifically binds to the CD3 antigen found on the surface of T cells. This antibody has been extensively studied and has shown promising results in both research and therapeutic applications. In this article, we will discuss the structure, activity, and potential applications of this antibody.

Structure

The Anti-Human CD3 Antibody (SP34) is a member of the immunoglobulin superfamily and is composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains only have a variable region. The variable regions are responsible for binding to the CD3 antigen on T cells.
The antibody is produced through hybridoma technology, where a mouse B cell is fused with a myeloma cell to create a hybrid cell line that can continuously produce the antibody. The resulting antibody is then purified and used for various applications.

Activity

The main function of the Anti-Human CD3 Antibody (SP34) is to bind to the CD3 antigen on T cells. This binding leads to the activation of T cells and the initiation of an immune response. The antibody can also induce the proliferation of T cells and the production of cytokines, which are important signaling molecules in the immune system.
Additionally, the Anti-Human CD3 Antibody (SP34) can also trigger the death of T cells through a process called antibody-dependent cell-mediated cytotoxicity (ADCC). This activity has been shown to be effective in eliminating cancer cells that express the CD3 antigen on their surface.

Therapeutic Target

The CD3 antigen is an important therapeutic target for a variety of diseases, including autoimmune disorders and cancer. The Anti-Human CD3 Antibody (SP34) has been studied as a potential treatment for these conditions due to its ability to modulate the immune response.
In autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis, the immune system mistakenly attacks the body’s own tissues. The Anti-Human CD3 Antibody (SP34) can target and deactivate the T cells responsible for this attack, reducing inflammation and providing relief for patients.
In cancer, the Anti-Human CD3 Antibody (SP34) has shown promise in treating certain types of leukemia and lymphoma. By binding to the CD3 antigen on cancer cells, the antibody can activate T cells to attack and kill these cells, leading to tumor regression and improved patient outcomes.

Research Use

Aside from its therapeutic potential, the Anti-Human CD3 Antibody (SP34) is also widely used in research. It has been used in studies to better understand the role of T cells in various diseases and to develop new treatments and therapies.
The antibody is also commonly used in flow cytometry, a technique that allows for the identification and analysis of different cell types. By labeling T cells with the Anti-Human CD3 Antibody (SP34), researchers can accurately measure the number and activity of these cells in a sample.

Conclusion

The Anti-Human CD3 Antibody (SP34) is a powerful tool in both research and therapeutic settings. Its ability to specifically target and activate T cells makes it a valuable asset in the fight against autoimmune disorders and cancer. With ongoing research and development, this antibody holds great potential for improving human health.

SDS-PAGE for Anti-Human CD3 Antibody (SP34)

SDS-PAGE for Anti-Human CD3 Antibody (SP34)

Anti-Human CD3 Antibody (SP34), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD3 Antibody (SP34)

There are no reviews yet.

Be the first to review “Anti-Human CD3 Antibody (SP34)”

Your email address will not be published. Required fields are marked *

Filter to find the right variant

Clonality
All
Target Species
All
Applications
All
Clone Name
All
Name SKU View Clone
Anti-Human CD3 Antibody (TR66), PE ARO-A10567 View Clone
Anti-Human CD3 Antibody (SP34), FITC ARO-A10810 View Clone
Anti-Human CD3 Antibody (SP34), PE ARO-A10569 View Clone
Anti-Human CD3 Antibody (TR66), APC ARO-A10298 View Clone
Anti-Human CD3 Antibody (UCHT1) ARO-A15384 View Clone
Anti-Human CD3 Antibody (SP34), APC ARO-A10300 View Clone
Muromonab-Cd3 Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1092 View Clone
Otelixizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1169 View Clone
Teplizumab Biosimilar - Anti-CD3 mAb - Research Grade PX-TA1617 View Clone
Visilizumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1066 View Clone
Foralumab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1245 View Clone
Dafsolimab Biosimilar - Anti-CD3E mAb - Research Grade PX-TA1652 View Clone
Human CD3E (OKT3) Monoclonal Antibody ARO-A15835 View Clone
Human CD3E (SPV-T3a) Monoclonal Antibody ARO-A15838 View Clone
Human CD3E (UCHT-1) Monoclonal Antibody ARO-A15841 View Clone
Human CD3E Monoclonal Antibody ARO-A15844 View Clone
Anti-Human CD3E Antibody (YTH12.5), FITC ARO-A10814 View Clone
Anti-Human CD3E Antibody (UCHT-1), FITC ARO-A10813 View Clone
Anti-Human CD3E Antibody (OKT3), FITC ARO-A10812 View Clone
Anti-Human CD3E Antibody (SPV-T3a), FITC ARO-A10811 View Clone
Anti-Human CD3 Antibody (UCHT1), FITC ARO-A10809 View Clone
Anti-Human CD3 Antibody (TR66), FITC ARO-A10504 View Clone
Anti-Human CD3E Antibody (TRX4), FITC ARO-A10808 View Clone
Anti-Human CD3 Antibody (HIT3a), FITC ARO-A10807 View Clone
Anti-Human CD3E Antibody (YTH12.5), APC ARO-A10304 View Clone
Anti-Human CD3E Antibody (UCHT-1), APC ARO-A10303 View Clone
Anti-Human CD3E Antibody (OKT3), APC ARO-A10302 View Clone
Anti-Human CD3E Antibody (SPV-T3a), APC ARO-A10301 View Clone
Anti-Human CD3 Antibody (UCHT1), APC ARO-A10299 View Clone
Anti-Human CD3E Antibody (TRX4), APC ARO-A10297 View Clone
Anti-Human CD3 Antibody (HIT3a), APC ARO-A10296 View Clone
Anti-Human CD3E Antibody (YTH12.5), PerCP ARO-A10053 View Clone
Anti-Human CD3E Antibody (UCHT-1), PerCP ARO-A10052 View Clone
Anti-Human CD3E Antibody (OKT3), PerCP ARO-A10051 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PerCP ARO-A10050 View Clone
Anti-Human CD3 Antibody (SP34), PerCP ARO-A10049 View Clone
Anti-Human CD3 Antibody (UCHT1), PerCP ARO-A10048 View Clone
Anti-Human CD3 Antibody (TR66), PerCP ARO-A10047 View Clone
Anti-Human CD3E Antibody (TRX4), PerCP ARO-A10046 View Clone
Anti-Human CD3 Antibody (HIT3a), PerCP ARO-A10045 View Clone
Anti-Human CD3E Antibody (YTH12.5), PE ARO-A10573 View Clone
Anti-Human CD3E Antibody (UCHT-1), PE ARO-A10572 View Clone
Anti-Human CD3E Antibody (OKT3), PE ARO-A10571 View Clone
Anti-Human CD3E Antibody (SPV-T3a), PE ARO-A10570 View Clone
Anti-Human CD3 Antibody (UCHT1), PE ARO-A10568 View Clone
Anti-Human CD3E Antibody (TRX4), PE ARO-A10566 View Clone
Anti-Human CD3 Antibody (HIT3a), PE ARO-A10565 View Clone
Anti-Human CD3E VHH (SAA1330) PTX18928-100 View Clone
InVivoMAb Anti-Human CD3E Antibody (38E4#) ARO-A13054 View Clone

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products